Reaction Details |
| Report a problem with these data |
Target | Fatty acid-binding protein 5 |
---|
Ligand | BDBM50212886 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_455935 (CHEMBL887936) |
---|
Ki | 290±n/a nM |
---|
Citation | Sulsky, R; Magnin, DR; Huang, Y; Simpkins, L; Taunk, P; Patel, M; Zhu, Y; Stouch, TR; Bassolino-Klimas, D; Parker, R; Harrity, T; Stoffel, R; Taylor, DS; Lavoie, TB; Kish, K; Jacobson, BL; Sheriff, S; Adam, LP; Ewing, WR; Robl, JA Potent and selective biphenyl azole inhibitors of adipocyte fatty acid binding protein (aFABP). Bioorg Med Chem Lett17:3511-5 (2007) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Fatty acid-binding protein 5 |
---|
Name: | Fatty acid-binding protein 5 |
Synonyms: | FABP5 | FABP5_HUMAN | Fatty acid binding protein epidermal | Fatty acid-binding protein 5 (FABP5) |
Type: | Enzyme |
Mol. Mass.: | 15164.79 |
Organism: | Homo sapiens (Human) |
Description: | Q01469 |
Residue: | 135 |
Sequence: | MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTL
KTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVEC
VMNNVTCTRIYEKVE
|
|
|
BDBM50212886 |
---|
n/a |
---|
Name | BDBM50212886 |
Synonyms: | CHEMBL247529 | [2'-(3-ethyl-4,5-diphenyl-furan-2-yl)-biphenyl-3-yloxy]-acetic acid |
Type | Small organic molecule |
Emp. Form. | C32H26O4 |
Mol. Mass. | 474.5464 |
SMILES | CCc1c(oc(c1-c1ccccc1)-c1ccccc1)-c1ccccc1-c1cccc(OCC(O)=O)c1 |
Structure |
|