| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Delta-type opioid receptor |
|---|
| Ligand | BDBM50213400 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_447456 (CHEMBL896479) |
|---|
| Ki | 4.6±n/a nM |
|---|
| Citation |  Trabanco, AA; Aerts, N; Alvarez, RM; Andrés, JI; Boeckx, I; Fernández, J; Gómez, A; Janssens, FE; Leenaerts, JE; De Lucas, AI; Matesanz, E; Steckler, T; Pullan, S 4-Phenyl-4-[1H-imidazol-2-yl]-piperidine derivatives as non-peptidic selective delta-opioid agonists with potential anxiolytic/antidepressant properties. Part 2. Bioorg Med Chem Lett17:3860-3 (2007) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Delta-type opioid receptor |
|---|
| Name: | Delta-type opioid receptor |
|---|
| Synonyms: | D-OR-1 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor (Delta) | OPIATE Delta | OPRD | OPRD1 | OPRD_HUMAN | OPRK1 | opioid receptor, delta 1 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 40382.98 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the delta opioid receptor. |
|---|
| Residue: | 372 |
|---|
| Sequence: | MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
|
|
|
|---|
| BDBM50213400 |
|---|
| n/a |
|---|
| Name | BDBM50213400 |
|---|
| Synonyms: | CHEMBL391623 | ethyl 4-(1-(4-hydroxybenzyl)-1H-imidazol-2-yl)-4-phenylpiperidine-1-carboxylate |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H27N3O3 |
|---|
| Mol. Mass. | 405.4895 |
|---|
| SMILES | CCOC(=O)N1CCC(CC1)(c1nccn1Cc1ccc(O)cc1)c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
