| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cannabinoid receptor 2 |
|---|
| Ligand | BDBM50213600 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_459064 (CHEMBL925156) |
|---|
| Ki | 105±n/a nM |
|---|
| Citation |  Durdagi, S; Kapou, A; Kourouli, T; Andreou, T; Nikas, SP; Nahmias, VR; Papahatjis, DP; Papadopoulos, MG; Mavromoustakos, T The application of 3D-QSAR studies for novel cannabinoid ligands substituted at the C1' position of the alkyl side chain on the structural requirements for binding to cannabinoid receptors CB1 and CB2. J Med Chem50:2875-85 (2007) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cannabinoid receptor 2 |
|---|
| Name: | Cannabinoid receptor 2 |
|---|
| Synonyms: | CANNABINOID CB2 | CB-2 | CB2 | CB2A | CB2B | CNR2 | CNR2_HUMAN | CX5 | Cannabinoid CB2 receptor | Cannabinoid receptor 2 (CB2) | Cannabinoid receptor 2 (CB2R) | hCB2 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 39690.94 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P34972 |
|---|
| Residue: | 360 |
|---|
| Sequence: | MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
|
|
|
|---|
| BDBM50213600 |
|---|
| n/a |
|---|
| Name | BDBM50213600 |
|---|
| Synonyms: | 1-(3,5-dihydroxy-4-((1R)-3-methyl-6-(prop-1-en-2-yl)cyclohex-2-enyl)phenyl)cyclopentanecarbonitrile | 1-[3,5-dihydroxy-4-((R)-6-isopropenyl-3-methyl-cyclohex-2-enyl)-phenyl]-cyclopentanecarbonitrile | CHEMBL238781 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H27NO2 |
|---|
| Mol. Mass. | 337.4553 |
|---|
| SMILES | CC(=C)C1CCC(C)=C[C@H]1c1c(O)cc(cc1O)C1(CCCC1)C#N |w:3.2,c:7| |
|---|
| Structure | 
|
|---|
Search and Browse
