Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetInterleukin-8 receptors, CXCR2
LigandBDBM50213737
Substrate/Competitorn/a
Meas. Tech.ChEMBL_447494
IC50 490±n/a nM
Citation Wang YBusch-Petersen JWang FMa LFu WKerns JKJin JPalovich MRShen JKBurman MFoley JJSchmidt DBHunsberger GESarau HMWiddowson KL 3-Arylamino-2H-1,2,4-benzothiadiazin-5-ol 1,1-dioxides as novel and selective CXCR2 antagonists. Bioorg Med Chem Lett 17:3864-7 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Interleukin-8 receptors, CXCR2
Name:Interleukin-8 receptors, CXCR1/CXCR2
Synonyms:C-X-C chemokine receptor type 2 (CXCR-2) | C-X-C chemokine receptor type 2 (CXCR2) | CD_antigen=CD182 | CDw128b | CXCR-2 | Chemokine receptor type 2 (CXCR2) | GRO/MGSA receptor | High affinity interleukin-8 receptor B | IL-8 receptor type 2 | IL-8R B | Interleukin-8 receptor B
Type:Protein
Mol. Mass.:40767.88
Organism:Homo sapiens (Human)
Description:P25025
Residue:360
Sequence:
MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYFVVIIYALVFL
LSLLGNSLVMLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCK
VVSLLKEVNFYSGILLLACISVDRYLAIVHATRTLTQKRYLVKFICLSIWGLSLLLALPV
LLFRRTVYSSNVSPACYEDMGNNTANWRMLLRILPQSFGFIVPLLIMLFCYGFTLRTLFK
AHMGQKHRAMRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQETCERRNHIDRALDATE
ILGILHSCLNPLIYAFIGQKFRHGLLKILAIHGLISKDSLPKDSRPSFVGSSSGHTSTTL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50213737
n/a
NameBDBM50213737
Synonyms:7-nitro-1,1-dioxo-3-(2-phenoxy-phenylamino)-1,4-dihydro-1lambda6-benzo[1,2,4]thiadiazin-5-ol | CHEMBL399203
TypeSmall organic molecule
Emp. Form.C19H14N4O6S
Mol. Mass.426.403
SMILESOc1cc(cc2c1N=C(Nc1ccccc1Oc1ccccc1)NS2(=O)=O)[N+]([O-])=O |t:8|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: