Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCasein kinase II alpha
LigandBDBM50214456
Substrate/Competitorn/a
Meas. Tech.ChEMBL_439082
Ki 137±n/a nM
Citation Nie ZPerretta CErickson PMargosiak SAlmassy RLu JAverill AYager KMChu S Structure-based design, synthesis, and study of pyrazolo[1,5-a][1,3,5]triazine derivatives as potent inhibitors of protein kinase CK2. Bioorg Med Chem Lett 17:4191-5 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Casein kinase II alpha
Name:Casein kinase II alpha
Synonyms:CK II | CK2 | CK2- alpha | CK2A1 | CSNK2A1 | Casein kinase II (CK2) | Casein kinase II alpha/beta | Casein kinase II subunit alpha | Casein kinase II subunit alpha (CK2 alpha) | Casein kinase II subunit alpha (CK2A1) | Casein kinase II subunit alpha (CK2a I174A) | Casein kinase II subunit alpha (CK2a V66A) | Casein kinase II subunit alpha (CK2a dm V66I174AA) | Casein kinase II subunit alpha (CK2a) | Casein kinase II subunit alpha (CK2α)
Type:Enzyme
Mol. Mass.:45151.12
Organism:Homo sapiens (Human)
Description:P68400
Residue:391
Sequence:
MSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINIT
NNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTD
FKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAE
FYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYD
QLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDF
LDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMGSSSMPGGSTPVSSANMMSGISSVPT
PSPLGPLAGSPVIAAANPLGMPVPAAAGAQQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50214456
n/a
NameBDBM50214456
Synonyms:2-(p-toluidino)-4-(phenethylamino)pyrazolo[1,5-a][1,3,5]triazine-8-carbonitrile | CHEMBL230248
TypeSmall organic molecule
Emp. Form.C21H19N7
Mol. Mass.369.4225
SMILESCc1ccc(Nc2nc(NCCc3ccccc3)n3ncc(C#N)c3n2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: