Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCasein Kinase II
LigandBDBM50214472
Substrate/Competitorn/a
Meas. Tech.ChEMBL_439083
Ki 260±n/a nM
Citation Nie ZPerretta CErickson PMargosiak SAlmassy RLu JAverill AYager KMChu S Structure-based design, synthesis, and study of pyrazolo[1,5-a][1,3,5]triazine derivatives as potent inhibitors of protein kinase CK2. Bioorg Med Chem Lett 17:4191-5 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Casein Kinase II
Name:Casein Kinase II
Synonyms:CK II | CK2- alpha
Type:Enzyme
Mol. Mass.:39238.74
Organism:Zea mays (Maize)
Description:n/a
Residue:332
Sequence:
MSKARVYADVNVLRPKEYWDYEALTVQWGEQDDYEVVRKVGRGKYSEVFEGINVNNNEKC
IIKILKPVKKKKIKREIKILQNLCGGPNIVKLLDIVRDQHSKTPSLIFEYVNNTDFKVLY
PTLTDYDIRYYIYELLKALDYCHSQGIMHRDVKPHNVMIDHELRKLRLIDWGLAEFYHPG
KEYNVRVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKI
AKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFMNADNQHLVSPEAIDFLDKLL
RYDHQERLTALEAMTHPYFQQVRAAENSRTRA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50214472
n/a
NameBDBM50214472
Synonyms:CHEMBL231095 | N,N'-DIPHENYLPYRAZOLO[1,5-A][1,3,5]TRIAZINE-2,4-DIAMINE | N2,N4-diphenylpyrazolo[1,5-a][1,3,5]triazine-2,4-diamine
TypeSmall organic molecule
Emp. Form.C17H14N6
Mol. Mass.302.3333
SMILESN(c1ccccc1)c1nc(Nc2ccccc2)n2nccc2n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: