| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Melanocortin receptor 3 |
|---|
| Ligand | BDBM50214688 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_448089 (CHEMBL898345) |
|---|
| Ki | 450±n/a nM |
|---|
| Citation |  Tran, JA; Tucci, FC; Jiang, W; Marinkovic, D; Chen, CW; Arellano, M; Markison, S; Fleck, BA; Wen, J; White, NS; Pontillo, J; Saunders, J; Marks, D; Hoare, SR; Madan, A; Foster, AC; Chen, C Pyrrolidinones as orally bioavailable antagonists of the human melanocortin-4 receptor with anti-cachectic activity. Bioorg Med Chem15:5166-76 (2007) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Melanocortin receptor 3 |
|---|
| Name: | Melanocortin receptor 3 |
|---|
| Synonyms: | MC3-R | MC3R | MC3R_HUMAN | Melanocortin MC3 | Melanocortin receptor (M3 and M4) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 36044.86 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P41968 |
|---|
| Residue: | 323 |
|---|
| Sequence: | MNASCCLPSVQPTLPNGSEHLQAPFFSNQSSSAFCEQVFIKPEVFLSLGIVSLLENILVI
LAVVRNGNLHSPMYFFLCSLAVADMLVSVSNALETIMIAIVHSDYLTFEDQFIQHMDNIF
DSMICISLVASICNLLAIAVDRYVTIFYALRYHSIMTVRKALTLIVAIWVCCGVCGVVFI
VYSESKMVIVCLITMFFAMMLLMGTLYVHMFLFARLHVKRIAALPPADGVAPQQHSCMKG
AVTITILLGVFIFCWAPFFLHLVLIITCPTNPYCICYTAHFNTYLVLIMCNSVIDPLIYA
FRSLELRNTFREILCGCNGMNLG
|
|
|
|---|
| BDBM50214688 |
|---|
| n/a |
|---|
| Name | BDBM50214688 |
|---|
| Synonyms: | 1-{4-[(1R)-2-(amino-3-methylbutyl)-6-fluorophenyl]-4-[(2R)-(3-aminopropionylamido)-3-(2,4-dichlorophenyl)propionyl]}-piperazine | CHEMBL236014 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C27H36Cl2FN5O2 |
|---|
| Mol. Mass. | 552.511 |
|---|
| SMILES | CC(C)C[C@H](N)c1cccc(F)c1N1CCN(CC1)C(=O)[C@@H](Cc1ccc(Cl)cc1Cl)NC(=O)CCN |
|---|
| Structure | 
|
|---|
Search and Browse
