| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Adenosine receptor A3 |
|---|
| Ligand | BDBM50214975 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_439361 (CHEMBL888475) |
|---|
| Ki | 7.4±n/a nM |
|---|
| Citation |  Jeong, LS; Choe, SA; Gunaga, P; Kim, HO; Lee, HW; Lee, SK; Tosh, DK; Patel, A; Palaniappan, KK; Gao, ZG; Jacobson, KA; Moon, HR Discovery of a new nucleoside template for human A3 adenosine receptor ligands: D-4'-thioadenosine derivatives without 4'-hydroxymethyl group as highly potent and selective antagonists. J Med Chem50:3159-62 (2007) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Adenosine receptor A3 |
|---|
| Name: | Adenosine receptor A3 |
|---|
| Synonyms: | A3 adenosine receptor (hA3) | AA3R_HUMAN | ADORA3 | Adenosine A3 receptor (A3AR) |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 36197.32 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P0DMS8 |
|---|
| Residue: | 318 |
|---|
| Sequence: | MPNNSTALSLANVTYITMEIFIGLCAIVGNVLVICVVKLNPSLQTTTFYFIVSLALADIA
VGVLVMPLAIVVSLGITIHFYSCLFMTCLLLIFTHASIMSLLAIAVDRYLRVKLTVRYKR
VTTHRRIWLALGLCWLVSFLVGLTPMFGWNMKLTSEYHRNVTFLSCQFVSVMRMDYMVYF
SFLTWIFIPLVVMCAIYLDIFYIIRNKLSLNLSNSKETGAFYGREFKTAKSLFLVLFLFA
LSWLPLSIINCIIYFNGEVPQLVLYMGILLSHANSMMNPIVYAYKIKKFKETYLLILKAC
VVCHPSDSLDTSIEKNSE
|
|
|
|---|
| BDBM50214975 |
|---|
| n/a |
|---|
| Name | BDBM50214975 |
|---|
| Synonyms: | (2R,3R,4S)-2-(2-chloro-6-(3-fluorobenzylamino)-9H-purin-9-yl)tetrahydrothiophene-3,4-diol | (2R,3R,4S)-2-(6-(3-fluorobenzylamino)-2-chloro-9H-purin-9-yl)-tetrahydrothiophene-3,4-diol | CHEMBL226581 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H15ClFN5O2S |
|---|
| Mol. Mass. | 395.839 |
|---|
| SMILES | O[C@@H]1CS[C@H]([C@@H]1O)n1cnc2c(NCc3cccc(F)c3)nc(Cl)nc12 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
