Reaction Details |
| Report a problem with these data |
Target | Adenosine receptor A3 |
---|
Ligand | BDBM50214976 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_439361 (CHEMBL888475) |
---|
Ki | 19.9±n/a nM |
---|
Citation | Jeong, LS; Choe, SA; Gunaga, P; Kim, HO; Lee, HW; Lee, SK; Tosh, DK; Patel, A; Palaniappan, KK; Gao, ZG; Jacobson, KA; Moon, HR Discovery of a new nucleoside template for human A3 adenosine receptor ligands: D-4'-thioadenosine derivatives without 4'-hydroxymethyl group as highly potent and selective antagonists. J Med Chem50:3159-62 (2007) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Adenosine receptor A3 |
---|
Name: | Adenosine receptor A3 |
Synonyms: | A3 adenosine receptor (hA3) | AA3R_HUMAN | ADORA3 | Adenosine A3 receptor (A3AR) |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 36197.32 |
Organism: | Homo sapiens (Human) |
Description: | P0DMS8 |
Residue: | 318 |
Sequence: | MPNNSTALSLANVTYITMEIFIGLCAIVGNVLVICVVKLNPSLQTTTFYFIVSLALADIA
VGVLVMPLAIVVSLGITIHFYSCLFMTCLLLIFTHASIMSLLAIAVDRYLRVKLTVRYKR
VTTHRRIWLALGLCWLVSFLVGLTPMFGWNMKLTSEYHRNVTFLSCQFVSVMRMDYMVYF
SFLTWIFIPLVVMCAIYLDIFYIIRNKLSLNLSNSKETGAFYGREFKTAKSLFLVLFLFA
LSWLPLSIINCIIYFNGEVPQLVLYMGILLSHANSMMNPIVYAYKIKKFKETYLLILKAC
VVCHPSDSLDTSIEKNSE
|
|
|
BDBM50214976 |
---|
n/a |
---|
Name | BDBM50214976 |
Synonyms: | (2R,3R,4S)-2-(2-chloro-6-(2-methoxybenzylamino)-9H-purin-9-yl)tetrahydrothiophene-3,4-diol | CHEMBL387740 |
Type | Small organic molecule |
Emp. Form. | C17H18ClN5O3S |
Mol. Mass. | 407.875 |
SMILES | COc1ccccc1CNc1nc(Cl)nc2n(cnc12)[C@@H]1SC[C@@H](O)[C@H]1O |
Structure |
|