Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGonadotropin releasing hormone 1 (GnRHR1)
LigandBDBM50215203
Substrate/Competitorn/a
Meas. Tech.ChEMBL_448200
Ki 5±n/a nM
Citation Lanier MCFeher MAshweek NJLoweth CJRueter JKSlee DHWilliams JPZhu YFSullivan SKBrown MS Selection, synthesis, and structure-activity relationship of tetrahydropyrido[4,3-d]pyrimidine-2,4-diones as human GnRH receptor antagonists. Bioorg Med Chem 15:5590-603 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Gonadotropin releasing hormone 1 (GnRHR1)
Name:Gonadotropin-releasing hormone receptor
Synonyms:GnRH receptor | GnRH-R | Gonadotropin-releasing hormone receptor | Gonadotropin-releasing hormone receptor (GnRH)
Type:Enzyme
Mol. Mass.:37749.45
Organism:Homo sapiens (Human)
Description:P30968
Residue:328
Sequence:
MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKL
QKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYL
KLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRM
IHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTR
VLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRL
SDPVNHFFFLFAFLNPCFDPLIYGYFSL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50215203
n/a
NameBDBM50215203
Synonyms:1-(2,6-difluorobenzyl)-6-(4-chloro-2-methylbenzyl)-3-(2-(methyl(2-(pyridin-2-yl)ethyl)amino)ethyl)-5,6,7,8-tetrahydropyrido[4,3-d]pyrimidine-2,4(1H,3H)-dione | CHEMBL392605
TypeSmall organic molecule
Emp. Form.C32H34ClF2N5O2
Mol. Mass.594.094
SMILESCN(CCc1ccccn1)CCn1c(=O)c2CN(Cc3ccc(Cl)cc3C)CCc2n(Cc2c(F)cccc2F)c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: