Reaction Details |
| Report a problem with these data |
Target | RAC-alpha serine/threonine-protein kinase |
---|
Ligand | BDBM50215763 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_456552 (CHEMBL922918) |
---|
IC50 | 15±n/a nM |
---|
Citation | Wickens, P; Kluender, H; Dixon, J; Brennan, C; Achebe, F; Bacchiocchi, A; Bankston, D; Bierer, D; Brands, M; Braun, D; Brown, MS; Chuang, CY; Dumas, J; Enyedy, I; Hofilena, G; Hong, Z; Housley, T; Jones, B; Khire, U; Kreiman, C; Kumarasinghe, E; Lowinger, T; Ott-Morgan, R; Perkins, L; Phillips, B; Schoenleber, R; Scott, WJ; Sheeler, R; Redman, A; Sun, X; Taylor, I; Wang, L; Wilhelm, S; Zhang, X; Zhang, M; Sullivan, E; Carter, C; Miglarese, M; Levy, J SAR of a novel 'Anthranilamide Like' series of VEGFR-2, multi protein kinase inhibitors for the treatment of cancer. Bioorg Med Chem Lett17:4378-81 (2007) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
RAC-alpha serine/threonine-protein kinase |
---|
Name: | RAC-alpha serine/threonine-protein kinase |
Synonyms: | AKT phosphorylation (p-AKT) | AKT1 | AKT1/PPP1CA | AKT1_HUMAN | C-AKT | PKB | PKB alpha | Protein kinase Akt-1 | Protein kinase B | Protein kinase B (AKT1) | Protein kinase B (Akt 1) | Protein kinase B (Akt) | Protein kinase B alpha | Protein kinase B alpha (AKT1) | Proto-oncogene Akt (Akt1) | Proto-oncogene c-Akt (AKT) | Proto-oncogene c-Akt (AKT1) | RAC | RAC-PK-alpha | RAC-alpha serine/threonine-protein kinase (AKT) | RAC-alpha serine/threonine-protein kinase (AKT1) | RAC-alpha serine/threonine-protein kinase (pAKT) |
Type: | Enzyme |
Mol. Mass.: | 55681.25 |
Organism: | Homo sapiens (Human) |
Description: | P31749 |
Residue: | 480 |
Sequence: | MSDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQREAPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKKQEEEEMDF
RSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFEL
ILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKK
LSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA
|
|
|
BDBM50215763 |
---|
n/a |
---|
Name | BDBM50215763 |
Synonyms: | 1-methyl-3-(5-((1-methyl-4-((4-(trifluoromethylthio)phenyl)carbamoyl)-1H-pyrazol-5-ylamino)methyl)pyridin-2-yl)urea | CHEMBL247797 |
Type | Small organic molecule |
Emp. Form. | C20H20F3N7O2S |
Mol. Mass. | 479.479 |
SMILES | CNC(=O)Nc1ccc(CNc2c(cnn2C)C(=O)Nc2ccc(SC(F)(F)F)cc2)cn1 |
Structure |
|