Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMast/stem cell growth factor receptor Kit
LigandBDBM50215763
Substrate/Competitorn/a
Meas. Tech.ChEMBL_456549
IC50 17±n/a nM
Citation Wickens PKluender HDixon JBrennan CAchebe FBacchiocchi ABankston DBierer DBrands MBraun DBrown MSChuang CYDumas JEnyedy IHofilena GHong ZHousley TJones BKhire UKreiman CKumarasinghe ELowinger TOtt-Morgan RPerkins LPhillips BSchoenleber RScott WJSheeler RRedman ASun XTaylor IWang LWilhelm SZhang XZhang MSullivan ECarter CMiglarese MLevy J SAR of a novel 'Anthranilamide Like' series of VEGFR-2, multi protein kinase inhibitors for the treatment of cancer. Bioorg Med Chem Lett 17:4378-81 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Mast/stem cell growth factor receptor Kit
Name:Mast/stem cell growth factor receptor Kit
Synonyms:CD117 antigen | CD_antigen=CD117 | KIT | Mast/stem cell growth factor receptor Kit (cKIT) | Proto-oncogene c-Kit | Proto-oncogene tyrosine-protein kinase Kit | SCFR | Stem cell growth factor receptor | Tyrosine Kinase c-Kit | Tyrosine-protein kinase Kit | Tyrosine-protein kinase Kit (c-Kit) | c-kit | p-145 c-kit | v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog
Type:Protein
Mol. Mass.:109869.37
Organism:Homo sapiens (Human)
Description:P10721
Residue:976
Sequence:
MRGARGAWDFLCVLLLLLRVQTGSSQPSVSPGEPSPPSIHPGKSDLIVRVGDEIRLLCTD
PGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLV
DRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKSVKRAYH
RLCLHCSVDQEGKSVLSEKFILKVRPAFKAVPVVSVSKASYLLREGEEFTVTCTIKDVSS
SVYSTWKRENSQTKLQEKYNSWHHGDFNYERQATLTISSARVNDSGVFMCYANNTFGSAN
VTTTLEVVDKGFINIFPMINTTVFVNDGENVDLIVEYEAFPKPEHQQWIYMNRTFTDKWE
DYPKSENESNIRYVSELHLTRLKGTEGGTYTFLVSNSDVNAAIAFNVYVNTKPEILTYDR
LVNGMLQCVAAGFPEPTIDWYFCPGTEQRCSASVLPVDVQTLNSSGPPFGKLVVQSSIDS
SAFKHNGTVECKAYNDVGKTSAYFNFAFKGNNKEQIHPHTLFTPLLIGFVIVAGMMCIIV
MILTYKYLQKPMYEVQWKVVEEINGNNYVYIDPTQLPYDHKWEFPRNRLSFGKTLGAGAF
GKVVEATAYGLIKSDAAMTVAVKMLKPSAHLTEREALMSELKVLSYLGNHMNIVNLLGAC
TIGGPTLVITEYCCYGDLLNFLRRKRDSFICSKQEDHAEAALYKNLLHSKESSCSDSTNE
YMDMKPGVSYVVPTKADKRRSVRIGSYIERDVTPAIMEDDELALDLEDLLSFSYQVAKGM
AFLASKNCIHRDLAARNILLTHGRITKICDFGLARDIKNDSNYVVKGNARLPVKWMAPES
IFNCVYTFESDVWSYGIFLWELFSLGSSPYPGMPVDSKFYKMIKEGFRMLSPEHAPAEMY
DIMKTCWDADPLKRPTFKQIVQLIEKQISESTNHIYSNLANCSPNRQKPVVDHSVRINSV
GSTASSSQPLLVHDDV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50215763
n/a
NameBDBM50215763
Synonyms:1-methyl-3-(5-((1-methyl-4-((4-(trifluoromethylthio)phenyl)carbamoyl)-1H-pyrazol-5-ylamino)methyl)pyridin-2-yl)urea | CHEMBL247797
TypeSmall organic molecule
Emp. Form.C20H20F3N7O2S
Mol. Mass.479.479
SMILESCNC(=O)Nc1ccc(CNc2c(cnn2C)C(=O)Nc2ccc(SC(F)(F)F)cc2)cn1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: