Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein kinase C delta
LigandBDBM50107112
Substrate/Competitorn/a
Meas. Tech.ChEMBL_440179
Ki 476±n/a nM
Citation Choi YPu YPeach MLKang JHLewin NESigano DMGarfield SHBlumberg PMMarquez VE Conformationally constrained analogues of diacylglycerol (DAG). 28. DAG-dioxolanones reveal a new additional interaction site in the C1b domain of PKC delta. J Med Chem 50:3465-81 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Protein kinase C delta
Name:Protein kinase C delta
Synonyms:Protein kinase C delta type | nPKC-delta
Type:PROTEIN
Mol. Mass.:77554.99
Organism:Mus musculus
Description:ChEMBL_1351519
Residue:674
Sequence:
MAPFLRISFNSYELGSLQVEDEASQPFCAVKMKEALSTERGKTLVQKKPTMYPEWKTTFD
AHIYEGRVIQIVLMRAAEDPVSEVTVGVSVLAERCKKNNGKAEFWLDLQPQAKVLMCVQY
FLEDGDCKQSMRSEEEAKFPTMNRRGAIKQAKIHYIKNHEFIATFFGQPTFCSVCKEFVW
GLNKQGYKCRQCNAAIHKKCIDKIIGRCTGTATNSRDTIFQKERFNIDMPHRFKVYNYMS
PTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLCGINQKLLAEALNQVTQRSSR
KLDTTESVGIYQGFEKKPEVSGSDILDNNGTYGKIWEGSTRCTLENFTFQKVLGKGSFGK
VLLAELKGKDKYFAIKCLKKDVVLIDDDVECTMVEKRVLALAWESPFLTHLICTFQTKDH
LFFVMEFLNGGDLMFHIQDKGRFELYRATFYAAEIICGLQFLHSKGIIYRDLKLDNVMLD
RDGHIKIADFGMCKENIFGEGRASTFCGTPDYIAPEILQGLKYSFSVDWWSFGVLLYEML
IGQSPFHGDDEDELFESIRVDTPHYPRWITKESKDIMEKLFERDPDKRLGVTGNIRIHPF
FKTINWSLLEKRKVEPPFKPKVKSPSDYSNFDPEFLNEKPQLSFSDKNLIDSMDQEAFHG
FSFVNPKFEQFLDI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50107112
n/a
NameBDBM50107112
Synonyms:(Z) 2,2-Dimethyl-propionic acid 2-hydroxymethyl-4-(3-isobutyl-5-methyl-hexylidene)-5-oxo-tetrahydro-furan-2-ylmethyl ester | (Z)-(2-(hydroxymethyl)-4-(3-isobutyl-5-methylhexylidene)-5-oxo-tetrahydrofuran-2-yl)methyl pivalate | (Z)-2-(2-(hydroxymethyl)-4-(3-isobutyl-5-methylhexylidene)-5-oxo-tetrahydrofuran-2-yl)ethyl pivalate | 2,2-Dimethyl-propionic acid 2-hydroxymethyl-4-(3-isobutyl-5-methyl-hexylidene)-5-oxo-tetrahydro-furan-2-ylmethyl ester | 2,2-Dimethyl-propionic acid 2-hydroxymethyl-4-[3-isobutyl-5-methyl-hex-(Z)-ylidene]-5-oxo-tetrahydro-furan-2-ylmethyl ester | CHEMBL96766 | DAG-lactone (HK-434)
TypeSmall organic molecule
Emp. Form.C22H38O5
Mol. Mass.382.5341
SMILESCC(C)CC(C\C=C1\CC(CO)(COC(=O)C(C)(C)C)OC1=O)CC(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: