Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCalcitonin gene-related peptide type 1 receptor/Receptor activity-modifying protein 1
LigandBDBM50217483
Substrate/Competitorn/a
Meas. Tech.ChEMBL_448633
Ki 35±n/a nM
Citation Shaw AWPaone DVNguyen DNStump CABurgey CSMosser SDSalvatore CARutledge RZKane SAKoblan KSGraham SLVacca JPWilliams TM Caprolactams as potent CGRP receptor antagonists for the treatment of migraine. Bioorg Med Chem Lett 17:4795-8 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Calcitonin gene-related peptide type 1 receptor/Receptor activity-modifying protein 1
Name:Calcitonin gene-related peptide type 1 receptor/Receptor activity-modifying protein 1
Synonyms:Calcitonin-gene-related peptide receptor, CALCRL/RAMP1
Type:n/a
Mol. Mass.:n/a
Description:ASSAY_ID of EBI is 327200
Components:This complex has 2 components.
Component 1
Name:Adrenomedullin receptor AM1; CALCRL/RAMP2
Synonyms:Calcitonin gene-related peptide (CGRP) receptor | Calcitonin gene-related peptide 1 (CGRP) | Calcitonin receptor-like receptor
Type:Enzyme
Mol. Mass.:52931.38
Organism:Homo sapiens (Human)
Description:Q16602
Residue:461
Sequence:
MEKKCTLNFLVLLPFFMILVTAELEESPEDSIQLGVTRNKIMTAQYECYQKIMQDPIQQA
EGVYCNRTWDGWLCWNDVAAGTESMQLCPDYFQDFDPSEKVTKICDQDGNWFRHPASNRT
WTNYTQCNVNTHEKVKTALNLFYLTIIGHGLSIASLLISLGIFFYFKSLSCQRITLHKNL
FFSFVCNSVVTIIHLTAVANNQALVATNPVSCKVSQFIHLYLMGCNYFWMLCEGIYLHTL
IVVAVFAEKQHLMWYYFLGWGFPLIPACIHAIARSLYYNDNCWISSDTHLLYIIHGPICA
ALLVNLFFLLNIVRVLITKLKVTHQAESNLYMKAVRATLILVPLLGIEFVLIPWRPEGKI
AEEVYDYIMHILMHFQGLLVSTIFCFFNGEVQAILRRNWNQYKIQFGNSFSNSEALRSAS
YTVSTISDGPGYSHDCPSEHLNGKSIHDIENVLLKPENLYN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:Calcitonin-gene-related peptide receptor, CALCRL/RAMP1
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:16992.80
Organism:Homo sapiens (Human)
Description:EBI_100673
Residue:148
Sequence:
MARALCRLPRRGLWLLLAHHLFMTTACQEANYGALLRELCLTQFQVDMEAVGETLWCDWG
RTIRSYRELADCTWHMAEKLGCFWPNAEVDRFFLAVHGRYFRSCPISGRAVRDPPGSILY
PFIVVPITVTLLVTALVVWQSKRTEGIV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50217483
n/a
NameBDBM50217483
Synonyms:(cis racemic)-N-(1-(cyclopropylmethyl)-2-oxo-5-phenylazepan-3-yl)-4-(2-oxo-4-phenyl-2,3-dihydroimidazol-1-yl)piperidine-1-carboxamide | (trans racemic)-N-(1-(cyclopropylmethyl)-2-oxo-5-phenylazepan-3-yl)-4-(2-oxo-4-phenyl-2,3-dihydroimidazol-1-yl)piperidine-1-carboxamide | CHEMBL235457
TypeSmall organic molecule
Emp. Form.C31H37N5O3
Mol. Mass.527.6572
SMILESO=C(NC1CC(CCN(CC2CC2)C1=O)c1ccccc1)N1CCC(CC1)n1cc([nH]c1=O)-c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: