Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetThymidine kinase
LigandBDBM50217806
Substrate/Competitorn/a
Meas. Tech.ChEMBL_444706
IC50 15000±n/a nM
Citation Robins MJNowak IRajwanshi VKMiranda KCannon JFPeterson MAAndrei GSnoeck RDe Clercq EBalzarini J Synthesis and antiviral evaluation of 6-(alkyl-heteroaryl)furo[2,3-d]pyrimidin-2(3H)-one nucleosides and analogues with ethynyl, ethenyl, and ethyl spacers at C6 of the furopyrimidine core. J Med Chem 50:3897-905 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Thymidine kinase
Name:Thymidine kinase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:37819.99
Organism:Varicella-zoster virus (strain Dumas) (HHV-3) (Human herpesvirus 3)
Description:ChEMBL_444706
Residue:341
Sequence:
MSTDKTDVKMGVLRIYLDGAYGIGKTTAAEEFLHHFAITPNRILLIGEPLSYWRNLAGED
AICGIYGTQTRRLNGDVSPEDAQRLTAHFQSLFCSPHAIMHAKISALMDTSTSDLVQVNK
EPYKIMLSDRHPIASTICFPLSRYLVGDMSPAALPGLLFTLPAEPPGTNLVVCTVSLPSH
LSRVSKRARPGETVNLPFVMVLRNVYIMLINTIIFLKTNNWHAGWNTLSFCNDVFKQKLQ
KSECIKLREVPGIEDTLFAVLKLPELCGEFGNILPLWAWGMETLSNCSRSMSPFVLSLEQ
TPQHAAQELKTLLPQMTPANMSSGAWNILKELVNAVQDNTS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50217806
n/a
NameBDBM50217806
Synonyms:3-(2-deoxy-D-erythro-pentofuranosyl)-6-(2-hexylpyrimid-5-yl)furo[2,3-d]pyrimidin-2(3H)-one | CHEMBL396223
TypeSmall organic molecule
Emp. Form.C21H26N4O5
Mol. Mass.414.4549
SMILESCCCCCCc1cnc(nc1)-c1cc2cn([C@H]3C[C@H](O)[C@@H](CO)O3)c(=O)nc2o1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: