Reaction Details |
| Report a problem with these data |
Target | Delta-type opioid receptor |
---|
Ligand | BDBM50024790 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_444757 (CHEMBL895004) |
---|
Ki | 4600±n/a nM |
---|
Citation | Hiebel, AC; Lee, YS; Bilsky, E; Giuvelis, D; Deschamps, JR; Parrish, DA; Aceto, MD; May, EL; Harris, LS; Coop, A; Dersch, CM; Partilla, JS; Rothman, RB; Cheng, K; Jacobson, AE; Rice, KC Probes for narcotic receptor mediated phenomena. 34. Synthesis and structure-activity relationships of a potent mu-agonist delta-antagonist and an exceedingly potent antinociceptive in the enantiomeric C9-substituted 5-(3-hydroxyphenyl)-N-phenylethylmorphan series. J Med Chem50:3765-76 (2007) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Delta-type opioid receptor |
---|
Name: | Delta-type opioid receptor |
Synonyms: | D-OR-1 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor (Delta) | OPIATE Delta | OPRD | OPRD1 | OPRD_HUMAN | OPRK1 | opioid receptor, delta 1 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 40382.98 |
Organism: | Homo sapiens (Human) |
Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the delta opioid receptor. |
Residue: | 372 |
Sequence: | MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
|
|
|
BDBM50024790 |
---|
n/a |
---|
Name | BDBM50024790 |
Synonyms: | CHEMBL2113282 |
Type | Small organic molecule |
Emp. Form. | C22H25NO2 |
Mol. Mass. | 335.4394 |
SMILES | [H][C@@]12CCC[C@@](CCN1CCc1ccccc1)(C2=O)c1cccc(O)c1 |THB:9:8:4.3.2:17| |
Structure |
|