Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGPR24
LigandBDBM50219036
Substrate/Competitorn/a
Meas. Tech.ChEMBL_445279
Ki 0.6±n/a nM
Citation Jiang YChen CALu KDaniewska IDe Leon JKong RForray CLi BHegde LGWolinsky TDCraig DAWetzel JMAndersen KMarzabadi MR Synthesis and SAR investigations for novel melanin-concentrating hormone 1 receptor (MCH1) antagonists Part 1. The discovery of arylacetamides as viable replacements for the dihydropyrimidinone moiety of an HTS hit. J Med Chem 50:3870-82 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
GPR24
Name:GPR24
Synonyms:Melanin Concentrating Hormone 1 | Melanin-concentrating hormone receptor | Melanin-concentrating hormone receptor 1
Type:Enzyme Catalytic Domain
Mol. Mass.:39740.39
Organism:RAT
Description:Melanin Concentrating Hormone 1 GPR24 RAT::P97639
Residue:360
Sequence:
QATCTGCMDLQTSLLSTGPNASNISDGQDNLTLPGSPPRTGSVSYINIIMPSVFGTICLL
GIVGNSTVIFAVVKKSKLHWCSNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGE
TMCTLITAMDANSQFTSTYILTAMTIDRYLATVHPISSTKFRKPSMATLVICLLWALSFI
SITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVKILQ
RMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLY
NAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRTVSNAQTADEERTESKGT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50219036
n/a
NameBDBM50219036
Synonyms:CHEMBL388440 | N-{3-[1-(3-{[hydroxy(diphenyl)acetyl]amino}propyl)-4-piperidinyl]-4-methylphenyl}-2-methylpropanamide
TypeSmall organic molecule
Emp. Form.C33H41N3O3
Mol. Mass.527.6969
SMILESCC(C)C(=O)Nc1ccc(C)c(c1)C1CCN(CCCNC(=O)C(O)(c2ccccc2)c2ccccc2)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: