Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGPR24
LigandBDBM50219054
Substrate/Competitorn/a
Meas. Tech.ChEMBL_445301
Ki 10±n/a nM
Citation Chen CAJiang YLu KDaniewska IMazza CGNegron LForray CParola TLi BHegde LGWolinsky TDCraig DAKong RWetzel JMAndersen KMarzabadi MR Synthesis and SAR investigations for novel melanin-concentrating hormone 1 receptor (MCH1) antagonists part 2: A hybrid strategy combining key fragments of HTS hits. J Med Chem 50:3883-90 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
GPR24
Name:GPR24
Synonyms:Melanin Concentrating Hormone 1 | Melanin-concentrating hormone receptor | Melanin-concentrating hormone receptor 1
Type:Enzyme Catalytic Domain
Mol. Mass.:39740.39
Organism:RAT
Description:Melanin Concentrating Hormone 1 GPR24 RAT::P97639
Residue:360
Sequence:
QATCTGCMDLQTSLLSTGPNASNISDGQDNLTLPGSPPRTGSVSYINIIMPSVFGTICLL
GIVGNSTVIFAVVKKSKLHWCSNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGE
TMCTLITAMDANSQFTSTYILTAMTIDRYLATVHPISSTKFRKPSMATLVICLLWALSFI
SITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVKILQ
RMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLY
NAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRTVSNAQTADEERTESKGT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50219054
n/a
NameBDBM50219054
Synonyms:2-methyl-N-{3-[1-(4-phenoxybenzyl)-4-piperidinyl]phenyl}-propanamide | CHEMBL389128
TypeSmall organic molecule
Emp. Form.C28H32N2O2
Mol. Mass.428.5659
SMILESCC(C)C(=O)Nc1cccc(c1)C1CCN(Cc2ccc(Oc3ccccc3)cc2)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: