Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein-tyrosine phosphatase 1B
LigandBDBM50219570
Substrate/Competitorn/a
Meas. Tech.ChEMBL_445832
Ki 3±n/a nM
Citation Wilson DPWan ZKXu WXKirincich SJFollows BCJoseph-McCarthy DForeman KMoretto AWu JZhu MBinnun EZhang YLTam MErbe DVTobin JXu XLeung LShilling ATam SYMansour TSLee J Structure-based optimization of protein tyrosine phosphatase 1B inhibitors: from the active site to the second phosphotyrosine binding site. J Med Chem 50:4681-98 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Protein-tyrosine phosphatase 1B
Name:Protein-tyrosine phosphatase 1B
Synonyms:PTP1B | Protein tyrosine phosphatase 1B (PTP1B) | Protein tyrosine phosphatase-1B (PTP1B) | Protein-tyrosine phosphatase 1B (PTP1B) | Tyrosine-protein phosphatase non-receptor type 1 | Tyrosine-protein phosphatase non-receptor type 1 (PTP1B)
Type:Protein phosphatase
Mol. Mass.:49963.76
Organism:Homo sapiens (Human)
Description:Human recombinant GST-fusion PTP1B (1-435).
Residue:435
Sequence:
MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLH
QEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLK
CAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWP
DFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKD
PSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLE
PPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEKGSPLNAAPYG
IESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSLPEKDEDHALSYWKPFLVNMCVATVLT
AGAYLCYRFLFNSNT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50219570
n/a
NameBDBM50219570
Synonyms:4-bromo-3-carboxymethoxy-5-{3-[(1-o-tolylcarbamoylpiperidin-4-ylmethyl)amino]phenyl}thiophene-2-carboxylic acid | CHEMBL397415
TypeSmall organic molecule
Emp. Form.C27H28BrN3O6S
Mol. Mass.602.497
SMILESCc1ccccc1NC(=O)N1CCC(CNc2cccc(c2)-c2sc(C(O)=O)c(OCC(O)=O)c2Br)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: