| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Delta-type opioid receptor |
|---|
| Ligand | BDBM50219929 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_449062 (CHEMBL898267) |
|---|
| Ki | >5000±n/a nM |
|---|
| Citation |  Takeuchi, K; Holloway, WG; McKinzie, JH; Suter, TM; Statnick, MA; Surface, PL; Emmerson, PJ; Thomas, EM; Siegel, MG; Matt, JE; Wolfe, CN; Mitch, CH Structure-activity relationship studies of carboxamido-biaryl ethers as opioid receptor antagonists (OpRAs). Part 1. Bioorg Med Chem Lett17:5349-52 (2007) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Delta-type opioid receptor |
|---|
| Name: | Delta-type opioid receptor |
|---|
| Synonyms: | D-OR-1 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor (Delta) | OPIATE Delta | OPRD | OPRD1 | OPRD_HUMAN | OPRK1 | opioid receptor, delta 1 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 40382.98 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the delta opioid receptor. |
|---|
| Residue: | 372 |
|---|
| Sequence: | MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
|
|
|
|---|
| BDBM50219929 |
|---|
| n/a |
|---|
| Name | BDBM50219929 |
|---|
| Synonyms: | 6-(4-(2-(benzylamino)ethyl)phenoxy)nicotinic acid | CHEMBL236395 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H20N2O3 |
|---|
| Mol. Mass. | 348.3951 |
|---|
| SMILES | OC(=O)c1ccc(Oc2ccc(CCNCc3ccccc3)cc2)nc1 |
|---|
| Structure | 
|
|---|
Search and Browse
