Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetKinesin-like protein 1
LigandBDBM50220159
Substrate/Competitorn/a
Meas. Tech.ChEMBL_446063
IC50 15±n/a nM
Citation Parrish CAAdams NDAuger KRBurgess JLCarson JDChaudhari AMCopeland RADiamond MADonatelli CADuffy KJFaucette LFFiner JTHuffman WFHugger EDJackson JRKnight SDLuo LMoore MLNewlander KARidgers LHSakowicz RShaw ANSung CMSutton DWood KWZhang SYZimmerman MNDhanak D Novel ATP-competitive kinesin spindle protein inhibitors. J Med Chem 50:4939-52 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Kinesin-like protein 1
Name:Kinesin-like protein 1
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:119138.97
Organism:Homo sapiens (Human)
Description:ChEMBL_1457426
Residue:1056
Sequence:
MASQPNSSAKKKEEKGKNIQVVVRCRPFNLAERKASAHSIVECDPVRKEVSVRTGGLADK
SSRKTYTFDMVFGASTKQIDVYRSVVCPILDEVIMGYNCTIFAYGQTGTGKTFTMEGERS
PNEEYTWEEDPLAGIIPRTLHQIFEKLTDNGTEFSVKVSLLEIYNEELFDLLNPSSDVSE
RLQMFDDPRNKRGVIIKGLEEITVHNKDEVYQILEKGAAKRTTAATLMNAYSSRSHSVFS
VTIHMKETTIDGEELVKIGKLNLVDLAGSENIGRSGAVDKRAREAGNINQSLLTLGRVIT
ALVERTPHVPYRESKLTRILQDSLGGRTRTSIIATISPASLNLEETLSTLEYAHRAKNIL
NKPEVNQKLTKKALIKEYTEEIERLKRDLAAAREKNGVYISEENFRVMSGKLTVQEEQIV
ELIEKIGAVEEELNRVTELFMDNKNELDQCKSDLQNKTQELETTQKHLQETKLQLVKEEY
ITSALESTEEKLHDAASKLLNTVEETTKDVSGLHSKLDRKKAVDQHNAEAQDIFGKNLNS
LFNNMEELIKDGSSKQKAMLEVHKTLFGNLLSSSVSALDTITTVALGSLTSIPENVSTHV
SQIFNMILKEQSLAAESKTVLQELINVLKTDLLSSLEMILSPTVVSILKINSQLKHIFKT
SLTVADKIEDQKKELDGFLSILCNNLHELQENTICSLVESQKQCGNLTEDLKTIKQTHSQ
ELCKLMNLWTERFCALEEKCENIQKPLSSVQENIQQKSKDIVNKMTFHSQKFCADSDGFS
QELRNFNQEGTKLVEESVKHSDKLNGNLEKISQETEQRCESLNTRTVYFSEQWVSSLNER
EQELHNLLEVVSQCCEASSSDITEKSDGRKAAHEKQHNIFLDQMTIDEDKLIAQNLELNE
TIKIGLTKLNCFLEQDLKLDIPTGTTPQRKSYLYPSTLVRTEPREHLLDQLKRKQPELLM
MLNCSENNKEETIPDVDVEEAVLGQYTEEPLSQEPSVDAGVDCSSIGGVPFFQHKKSHGK
DKENRGINTLERSKVEETTEHLVTKSRLPLRAQINL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50220159
n/a
NameBDBM50220159
Synonyms:CHEMBL389589 | N-[3'-fluoro-4'-(trifluoromethyl)-1,1'-biphenyl-4-yl]sulfamide | N-[3'-fluoro-4'-(trifluoromethyl)-4-biphenylyl]sulfamide
TypeSmall organic molecule
Emp. Form.C13H10F4N2O2S
Mol. Mass.334.289
SMILESNS(=O)(=O)Nc1ccc(cc1)-c1ccc(c(F)c1)C(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: