Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMelanocortin receptor 4
LigandBDBM50221120
Substrate/Competitorn/a
Meas. Tech.ChEMBL_449492
Ki 1±n/a nM
Citation Jiang WTucci FCTran JAFleck BAWen JMarkison SMarinkovic DChen CWArellano MHoare SRJohns MFoster ACSaunders JChen C Pyrrolidinones as potent functional antagonists of the human melanocortin-4 receptor. Bioorg Med Chem Lett 17:5610-3 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Melanocortin receptor 4
Name:Melanocortin receptor 4
Synonyms:MC4-R
Type:PROTEIN
Mol. Mass.:36892.87
Organism:Rattus norvegicus
Description:ChEMBL_104260
Residue:332
Sequence:
MNSTHHHGMYTSLHLWNRSSHGLHGNASESLGKGHSDGGCYEQLFVSPEVFVTLGVISLL
ENILVIVAIAKNKNLHSPMYFFICSLAVADMLVSVSNGSETIVITLLNSTDTDAQSFTVN
IDNVIDSVICSSLLASICSLLSIAVDRYFTIFYALQYHNIMTVRRVGIIISCIWAACTVS
GVLFIIYSDSSAVIICLITMFFTMLVLMASLYVHMFLMARLHIKRIAVLPGTGTIRQGAN
MKGAITLTILIGVFVVCWAPFFLHLLFYISCPQNPYCVCFMSHFNLYLILIMCNAVIDPL
IYALRSQELRKTFKEIICFYPLGGICELPGRY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50221120
n/a
NameBDBM50221120
Synonyms:1-((R)-1-(4-(2-((S)-1-(2-aminoethylamino)-3-methylbutyl)-6-fluorophenyl)piperazin-1-yl)-3-(2,4-dichlorophenyl)-1-oxopropan-2-yl)pyrrolidin-2-one | CHEMBL393576 | N-(1-aminoethyl)-N-[(1S)-(2-{4-[(2R)-(2-oxo-1-pyrrolidinyl)-3-(2,4-dichlorophenyl)propionyl]-1-piperazinyl}-3-fluorophenyl)-3-methylbutyl]amine
TypeSmall organic molecule
Emp. Form.C30H40Cl2FN5O2
Mol. Mass.592.575
SMILESCC(C)C[C@H](NCCN)c1cccc(F)c1N1CCN(CC1)C(=O)[C@@H](Cc1ccc(Cl)cc1Cl)N1CCCC1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: