Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosine-protein kinase SYK
LigandBDBM50221531
Substrate/Competitorn/a
Meas. Tech.ChEMBL_457647
Ki 41±n/a nM
Citation Pannala MKher SWilson NGaudette JSircar IZhang SHBakhirev AYang GYuen PGorcsan FSakurai NBarbosa MCheng JF Synthesis and structure-activity relationship of 4-(2-aryl-cyclopropylamino)-quinoline-3-carbonitriles as EGFR tyrosine kinase inhibitors. Bioorg Med Chem Lett 17:5978-82 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Tyrosine-protein kinase SYK
Name:Tyrosine-protein kinase SYK
Synonyms:Lysyl-tRNA synthetase | SYK | Spleen Tyrosine Kinase | Spleen tyrosine kinase (SYK) | Tyrosine-protein kinase SYK (Syk)
Type:Enzyme
Mol. Mass.:72079.99
Organism:Homo sapiens (Human)
Description:P43405
Residue:635
Sequence:
MASSGMADSANHLPFFFGNITREEAEDYLVQGGMSDGLYLLRQSRNYLGGFALSVAHGRK
AHHYTIERELNGTYAIAGGRTHASPADLCHYHSQESDGLVCLLKKPFNRPQGVQPKTGPF
EDLKENLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGKISREESEQ
IVLIGSKTNGKFLIRARDNNGSYALCLLHEGKVLHYRIDKDKTGKLSIPEGKKFDTLWQL
VEHYSYKADGLLRVLTVPCQKIGTQGNVNFGGRPQLPGSHPATWSAGGIISRIKSYSFPK
PGHRKSSPAQGNRQESTVSFNPYEPELAPWAADKGPQREALPMDTEVYESPYADPEEIRP
KEVYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAE
ANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSM
GMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYA
PECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPRE
MYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50221531
n/a
NameBDBM50221531
Synonyms:6-methoxy-7-(3-(4-methylpiperazin-1-yl)propoxy)-4-((1R,2S)-2-phenylcyclopropylamino)quinoline-3-carbonitrile | CHEMBL248393
TypeSmall organic molecule
Emp. Form.C28H33N5O2
Mol. Mass.471.5939
SMILESCOc1cc2c(N[C@@H]3C[C@H]3c3ccccc3)c(cnc2cc1OCCCN1CCN(C)CC1)C#N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: