Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetUrease
LigandBDBM50223157
Substrate/Competitorn/a
Meas. Tech.ChEMBL_458108
Ki 135±n/a nM
Citation Sivapriya KSuguna PBanerjee ASaravanan VRao DNChandrasekaran S Facile one-pot synthesis of thio and selenourea derivatives: a new class of potent urease inhibitors. Bioorg Med Chem Lett 17:6387-91 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Urease
Name:Urease
Synonyms:Urea amidohydrolase
Type:Enzyme
Mol. Mass.:90746.20
Organism:Canavalia ensiformis (Jack bean) (Horse bean)
Description:P07374
Residue:840
Sequence:
MKLSPREVEKLGLHNAGYLAQKRLARGVRLNYTEAVALIASQIMEYARDGEKTVAQLMCL
GQHLLGRRQVLPAVPHLLNAVQVEATFPDGTKLVTVHDPISRENGELQEALFGSLLPVPS
LDKFAETKEDNRIPGEILCEDECLTLNIGRKAVILKVTSKGDRPIQVGSHYHFIEVNPYL
TFDRRKAYGMRLNIAAGTAVRFEPGDCKSVTLVSIEGNKVIRGGNAIADGPVNETNLEAA
MHAVRSKGFGHEEEKDASEGFTKEDPNCPFNTFIHRKEYANKYGPTTGDKIRLGDTNLLA
EIEKDYALYGDECVFGGGKVIRDGMGQSCGHPPAISLDTVITNAVIIDYTGIIKADIGIK
DGLIASIGKAGNPDIMNGVFSNMIIGANTEVIAGEGLIVTAGAIDCHVHYICPQLVYEAI
SSGITTLVGGGTGPAAGTRATTCTPSPTQMRLMLQSTDDLPLNFGFTGKGSSSKPDELHE
IIKAGAMGLKLHEDWGSTPAAIDNCLTIAEHHDIQINIHTDTLNEAGFVEHSIAAFKGRT
IHTYHSEGAGGGHAPDIIKVCGIKNVLPSSTNPTRPLTSNTIDEHLDMLMVCHHLDREIP
EDLAFAHSRIRKKTIAAEDVLNDIGAISIISSDSQAMGRVGEVISRTWQTADKMKAQTGP
LKCDSSDNDNFRIRRYIAKYTINPAIANGFSQYVGSVEVGKLADLVMWKPSFFGTKPEMV
IKGGMVAWADIGDPNASIPTPEPVKMRPMYGTLGKAGGALSIAFVSKAALDQRVNVLYGL
NKRVEAVSNVRKLTKLDMKLNDALPEITVDPESYTVKADGKLLCVSEATTVPLSRNYFLF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50223157
n/a
NameBDBM50223157
Synonyms:3-(4-bromobenzyl)-1,1-dimethylselenourea | CHEMBL398715
TypeSmall organic molecule
Emp. Form.C10H13BrN2Se
Mol. Mass.320.09
SMILESCN(C)C(=[Se])NCc1ccc(Br)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: