Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase Chk1
LigandBDBM50223478
Substrate/Competitorn/a
Meas. Tech.ChEMBL_458175
IC50 0.500000±n/a nM
Citation Garbaccio RMHuang STasber ESFraley MEYan YMunshi SIkuta MKuo LKreatsoulas CStirdivant SDrakas BRickert KWalsh ESHamilton KABuser CAHardwick JMao XBeck SCAbrams MTTao WLobell RSepp-Lorenzino LHartman GD Synthesis and evaluation of substituted benzoisoquinolinones as potent inhibitors of Chk1 kinase. Bioorg Med Chem Lett 17:6280-5 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein kinase Chk1
Name:Serine/threonine-protein kinase Chk1/2
Synonyms:CHK1 checkpoint homolog | Checkpoint kinase-1 (CHK1) | Serine/threonine-protein kinase Chk1
Type:Enzyme Catalytic Domain
Mol. Mass.:54443.02
Organism:Homo sapiens (Human)
Description:gi_166295192
Residue:476
Sequence:
MAVPFVEDWDLVQTLGEGAYGEVQLAVNRVTEEAVAVKIVDMKRAVDCPENIKKEICINK
MLNHENVVKFYGHRREGNIQYLFLEYCSGGELFDRIEPDIGMPEPDAQRFFHQLMAGVVY
LHGIGITHRDIKPENLLLDERDNLKISDFGLATVFRYNNRERLLNKMCGTLPYVAPELLK
RREFHAEPVDVWSCGIVLTAMLAGELPWDQPSDSCQEYSDWKEKKTYLNPWKKIDSAPLA
LLHKILVENPSARITIPDIKKDRWYNKPLKKGAKRPRVTSGGVSESPSGFSKHIQSNLDF
SPVNSASSEENVKYSSSQPEPRTGLSLWDTSPSYIDKLVQGISFSQPTCPDHMLLNSQLL
GTPGSSQNPWQRLVKRMTRFFTKLDADKSYQCLKETCEKLGYQWKKSCMNQVTISTTDRR
NNKLIFKVNLLEMDDKILVDFRLSKGDGLEFKRHFLKIKGKLIDIVSSQKIWLPAT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50223478
n/a
NameBDBM50223478
Synonyms:6-(2-aminoethyl)-9-(1H-pyrrol-2-yl)benzo[h]isoquinolin-1(2H)-one | CHEMBL249429
TypeSmall organic molecule
Emp. Form.C19H17N3O
Mol. Mass.303.3578
SMILESNCCc1cc2cc[nH]c(=O)c2c2cc(ccc12)-c1ccc[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: