Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetThymidylate kinase
LigandBDBM50223800
Substrate/Competitorn/a
Meas. Tech.ChEMBL_450257
Ki 7800±n/a nM
Citation Van Daele IMunier-Lehmann HFroeyen MBalzarini JVan Calenbergh S Rational design of 5'-thiourea-substituted alpha-thymidine analogues as thymidine monophosphate kinase inhibitors capable of inhibiting mycobacterial growth. J Med Chem 50:5281-92 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Thymidylate kinase
Name:Thymidylate kinase
Synonyms:TMPK | Thymidine monophosphate kinase | dTMP kinase
Type:PROTEIN
Mol. Mass.:22636.29
Organism:Mycobacterium tuberculosis
Description:ChEMBL_208218
Residue:214
Sequence:
MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQSVAADIAAEALHGEHGDLA
SSVYAMATLFALDRAGAVHTIQGLCRGYDVVILDRYVASNAAYSAARLHENAAGKAAAWV
QRIEFARLGLPKPDWQVLLAVSAELAGERSRGRAQRDPGRARDNYERDAELQQRTGAVYA
ELAAQGWGGRWLVVGADVDPGRLAATLAPPDVPS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50223800
n/a
NameBDBM50223800
Synonyms:CHEMBL393791 | N-(5'-deoxy-alpha-D-thymidin-5'-yl)-N'-(4-methylphenyl)thiourea
TypeSmall organic molecule
Emp. Form.C18H22N4O4S
Mol. Mass.390.457
SMILESCc1ccc(NC(=S)NC[C@H]2O[C@@H](C[C@@H]2O)n2cc(C)c(=O)[nH]c2=O)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: