| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Thymidylate kinase |
|---|
| Ligand | BDBM50223802 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_450257 (CHEMBL900534) |
|---|
| Ki | 15000±n/a nM |
|---|
| Citation |  Van Daele, I; Munier-Lehmann, H; Froeyen, M; Balzarini, J; Van Calenbergh, S Rational design of 5'-thiourea-substituted alpha-thymidine analogues as thymidine monophosphate kinase inhibitors capable of inhibiting mycobacterial growth. J Med Chem50:5281-92 (2007) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Thymidylate kinase |
|---|
| Name: | Thymidylate kinase |
|---|
| Synonyms: | KTHY_MYCTU | TMPK | Thymidine monophosphate kinase | dTMP kinase | tmk |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 22636.29 |
|---|
| Organism: | Mycobacterium tuberculosis |
|---|
| Description: | ChEMBL_208218 |
|---|
| Residue: | 214 |
|---|
| Sequence: | MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQSVAADIAAEALHGEHGDLA
SSVYAMATLFALDRAGAVHTIQGLCRGYDVVILDRYVASNAAYSAARLHENAAGKAAAWV
QRIEFARLGLPKPDWQVLLAVSAELAGERSRGRAQRDPGRARDNYERDAELQQRTGAVYA
ELAAQGWGGRWLVVGADVDPGRLAATLAPPDVPS
|
|
|
|---|
| BDBM50223802 |
|---|
| n/a |
|---|
| Name | BDBM50223802 |
|---|
| Synonyms: | ((1R,2S,4S)-2-hydroxy-4-(5-methyl-2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)cyclopentyl)methyl dihydrogen phosphate | CHEMBL393853 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C11H17N2O7P |
|---|
| Mol. Mass. | 320.2356 |
|---|
| SMILES | Cc1cn([C@@H]2C[C@H](O)[C@@H](COP(O)(O)=O)C2)c(=O)[nH]c1=O |
|---|
| Structure | 
|
|---|
Search and Browse
