Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCathepsin K
LigandBDBM50223940
Substrate/Competitorn/a
Meas. Tech.ChEMBL_458256
IC50 4±n/a nM
Citation Teno NMiyake TEhara TIrie OSakaki JOhmori OGunji HMatsuura NMasuya KHitomi YNonomura KHoriuchi MGohda KIwasaki AUmemura ITada SKometani MIwasaki GCowan-Jacob SWMissbach MLattmann RBetschart C Novel scaffold for cathepsin K inhibitors. Bioorg Med Chem Lett 17:6096-100 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cathepsin K
Name:Cathepsin K
Synonyms:CTSK | CTSO | CTSO2 | Cathepsin O | Cathepsin O2 | Cathepsin X
Type:Enzyme
Mol. Mass.:36975.68
Organism:Homo sapiens (Human)
Description:P43235
Residue:329
Sequence:
MWGLKVLLLPVVSFALYPEEILDTHWELWKKTHRKQYNNKVDEISRRLIWEKNLKYISIH
NLEASLGVHTYELAMNHLGDMTSEEVVQKMTGLKVPLSHSRSNDTLYIPEWEGRAPDSVD
YRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGG
YMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVA
RVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGE
NWGNKGYILMARNKNNACGIANLASFPKM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50223940
n/a
NameBDBM50223940
Synonyms:6-((4,5-dichloro-1H-imidazol-1-yl)methyl)-7-neopentyl-7H-pyrrolo[2,3-d]pyrimidine-2-carbonitrile | CHEMBL250165
TypeSmall organic molecule
Emp. Form.C16H16Cl2N6
Mol. Mass.363.244
SMILESCC(C)(C)Cn1c(Cn2cnc(Cl)c2Cl)cc2cnc(nc12)C#N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: