Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetP2X purinoceptor 7 (P2X7)
LigandBDBM50411437
Substrate/Competitorn/a
Meas. Tech.ChEMBL_451545
IC50 251±n/a nM
Citation Furber MAlcaraz LBent JEBeyerbach ABowers KBraddock MCaffrey MVCladingboel DCollington JDonald DKFagura MInce FKinchin ECLaurent CLawson MLuker TJMortimore MMPimm ADRiley RJRoberts NRobertson MTheaker JThorne PVWeaver RWebborn PWillis P Discovery of potent and selective adamantane-based small-molecule P2X(7) receptor antagonists/interleukin-1beta inhibitors. J Med Chem 50:5882-5 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
P2X purinoceptor 7 (P2X7)
Name:P2X purinoceptor 7
Synonyms:ATP receptor | P2X purinoceptor 7 | P2X purinoceptor 7 (P2RX7) | P2X7 | P2Z receptor | Purinergic receptor
Type:Protein
Mol. Mass.:68403.50
Organism:Rattus norvegicus (Rat)
Description:Q64663
Residue:595
Sequence:
MPACCSWNDVFQYETNKVTRIQSVNYGTIKWILHMTVFSYVSFALMSDKLYQRKEPLISS
VHTKVKGVAEVTENVTEGGVTKLVHGIFDTADYTLPLQGNSFFVMTNYLKSEGQEQKLCP
EYPSRGKQCHSDQGCIKGWMDPQSKGIQTGRCIPYDQKRKTCEIFAWCPAEEGKEAPRPA
LLRSAENFTVLIKNNIDFPGHNYTTRNILPGMNISCTFHKTWNPQCPIFRLGDIFQEIGE
NFTEVAVQGGIMGIEIYWDCNLDSWSHRCQPKYSFRRLDDKYTNESLFPGYNFRYAKYYK
ENGMEKRTLIKAFGVRFDILVFGTGGKFDIIQLVVYIGSTLSYFGLATVCIDLIINTYAS
TCCRSRVYPSCKCCEPCAVNEYYYRKKCEPIVEPKPTLKYVSFVDEPHIWMVDQQLLGKS
LQDVKGQEVPRPQTDFLELSRLSLSLHHSPPIPGQPEEMQLLQIEAVPRSRDSPDWCQCG
NCLPSQLPENRRALEELCCRRKPGQCITTSELFSKIVLSREALQLLLLYQEPLLALEGEA
INSKLRHCAYRSYATWRFVSQDMADFAILPSCCRWKIRKEFPKTQGQYSGFKYPY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50411437
n/a
NameBDBM50411437
Synonyms:CHEMBL392559
TypeSmall organic molecule
Emp. Form.C24H32ClN3O
Mol. Mass.413.983
SMILESClc1ccc(CN2C[C@@H]3C[C@H]2CN3)cc1C(=O)NCC12CC3CC(CC(C3)C1)C2 |TLB:18:19:22:26.24.25,THB:24:23:20:26.25.27,24:25:22.23.28:20,27:25:22:28.19.20,27:19:22:26.24.25|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: