Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFarnesyl diphosphate synthase
LigandBDBM50226002
Substrate/Competitorn/a
Meas. Tech.ChEMBL_451825
IC50 253500±n/a nM
Citation Marma MSXia ZStewart CCoxon FDunford JEBaron RKashemirov BAEbetino FHTriffitt JTRussell RGMcKenna CE Synthesis and biological evaluation of alpha-halogenated bisphosphonate and phosphonocarboxylate analogues of risedronate. J Med Chem 50:5967-75 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Farnesyl diphosphate synthase
Name:Farnesyl diphosphate synthase
Synonyms:Dimethylallyltranstransferase | FPP synthase | FPP synthetase | FPS | Farnesyl diphosphate synthase (FPPS) | Farnesyl diphosphate synthetase | Farnesyl pyrophosphate synthase (FPPS) | Farnesyl pyrophosphate synthetase | Geranyltranstransferase | P14324
Type:Enzyme
Mol. Mass.:48272.89
Organism:Homo sapiens (Human)
Description:P14324
Residue:419
Sequence:
MPLSRWLRSVGVFLLPAPYWAPRERWLGSLRRPSLVHGYPVLAWHSARCWCQAWTEEPRA
LCSSLRMNGDQNSDVYAQEKQDFVQHFSQIVRVLTEDEMGHPEIGDAIARLKEVLEYNAI
GGKYNRGLTVVVAFRELVEPRKQDADSLQRAWTVGWCVELLQAFFLVADDIMDSSLTRRG
QICWYQKPGVGLDAINDANLLEACIYRLLKLYCREQPYYLNLIELFLQSSYQTEIGQTLD
LLTAPQGNVDLVRFTEKRYKSIVKYKTAFYSFYLPIAAAMYMAGIDGEKEHANAKKILLE
MGEFFQIQDDYLDLFGDPSVTGKIGTDIQDNKCSWLVVQCLQRATPEQYQILKENYGQKE
AEKVARVKALYEELDLPAVFLQYEEDSYSHIMALIEQYAAPLPPAVFLGLARKIYKRRK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50226002
n/a
NameBDBM50226002
Synonyms:(R)-2-hydroxy-2-phosphono-3-(pyridin-3-yl)propanoic acid | 2-hydroxy-2-phosphono-3-(pyridin-3-yl)propanoic acid | 3-(3-Pyridyl)-2-hydroxy-2-phosphonopropanoic acid | CHEMBL397829
TypeSmall organic molecule
Emp. Form.C8H10NO6P
Mol. Mass.247.1419
SMILESOC(=O)C(O)(Cc1cccnc1)P(O)(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: