Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarboxypeptidase B
LigandBDBM50226610
Substrate/Competitorn/a
Meas. Tech.ChEMBL_452075
Ki 206±n/a nM
Citation Bunnage MEBlagg JSteele JOwen DRAllerton CMcElroy ABMiller DRinger TButcher KBeaumont KEvans KGray AJHolland SJFeeder NMoore RSBrown DG Discovery of potent& selective inhibitors of activated thrombin-activatable fibrinolysis inhibitor for the treatment of thrombosis. J Med Chem 50:6095-103 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carboxypeptidase B
Name:Carboxypeptidase B
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:47371.10
Organism:Sus scrofa
Description:ChEMBL_453905
Residue:416
Sequence:
MLAFLILVTVTLASAHHSGEHFEGEKVFRVNVEDENDISLLHELASTRQIDFWKPDSVTQ
IKPHSTVDFRVKAEDILAVEDFLEQNELQYEVLINNLRSVLEAQFDSRVRTTGHSYEKYN
NWETIEAWTKQVTSENPDLISRTAIGTTFLGNNIYLLKVGKPGPNKPAIFMDCGFHAREW
ISHAFCQWFVREAVLTYGYESHMTEFLNKLDFYVLPVLNIDGYIYTWTKNRMWRKTRSTN
AGTTCIGTDPNRNFDAGWCTTGASTDPCDETYCGSAAESEKETKALADFIRNNLSSIKAY
LTIHSYSQMILYPYSYDYKLPENNAELNNLAKAAVKELATLYGTKYTYGPGATTIYPAAG
GSDDWAYDQGIKYSFTFELRDKGRYGFILPESQIQATCEETMLAIKYVTNYVLGHL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50226610
n/a
NameBDBM50226610
Synonyms:(2S)-5-AMINO-2-[(1-PROPYL-1H-IMIDAZOL-4-YL)METHYL]PENTANOIC ACID | (2S)-5-amino-2-[(1-n-propyl-1H-imidazol-4-yl)methyl]-pentanoic acid | (S)-5-amino-2-((1-propyl-1H-imidazol-4-yl)methyl)pentanoic acid | CHEMBL398110
TypeSmall organic molecule
Emp. Form.C12H21N3O2
Mol. Mass.239.314
SMILESCCCn1cnc(C[C@H](CCCN)C(O)=O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: