Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarboxypeptidase A1
LigandBDBM50109593
Substrate/Competitorn/a
Meas. Tech.ChEMBL_452073
Ki 11±n/a nM
Citation Bunnage MEBlagg JSteele JOwen DRAllerton CMcElroy ABMiller DRinger TButcher KBeaumont KEvans KGray AJHolland SJFeeder NMoore RSBrown DG Discovery of potent& selective inhibitors of activated thrombin-activatable fibrinolysis inhibitor for the treatment of thrombosis. J Med Chem 50:6095-103 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carboxypeptidase A1
Name:Carboxypeptidase A1
Synonyms:CPA1 | Carboxypeptidase A | Carboxypeptidase A (CPA) | Carboxypeptidase A1 precursor
Type:Enzyme
Mol. Mass.:47073.90
Organism:Bos taurus (bovine)
Description:From Sigma-Aldrich Co.
Residue:419
Sequence:
MQGLLILSVLLGAALGKEDFVGHQVLRITAADEAEVQTVKELEDLEHLQLDFWRGPGQPG
SPIDVRVPFPSLQAVKVFLEAHGIRYRIMIEDVQSLLDEEQEQMFASQSRARSTNTFNYA
TYHTLDEIYDFMDLLVAEHPQLVSKLQIGRSYEGRPIYVLKFSTGGSNRPAIWIDLGIHS
REWITQATGVWFAKKFTEDYGQDPSFTAILDSMDIFLEIVTNPDGFAFTHSQNRLWRKTR
SVTSSSLCVGVDANRNWDAGFGKAGASSSPCSETYHGKYANSEVEVKSIVDFVKDHGNFK
AFLSIHSYSQLLLYPYGYTTQSIPDKTELNQVAKSAVEALKSLYGTSYKYGSIITTIYQA
SGGSIDWSYNQGIKYSFTFELRDTGRYGFLLPASQIIPTAQETWLGVLTIMEHTLNNLY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50109593
n/a
NameBDBM50109593
Synonyms:2-Benzyl-3-mercapto-propionic acid | 2-Mercaptomethyl-3-phenyl-propionic acid | CHEMBL58957 | SQ-14603
TypeSmall organic molecule
Emp. Form.C10H12O2S
Mol. Mass.196.266
SMILESOC(=O)C(CS)Cc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: