Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetC-X-C chemokine receptor type 1
LigandBDBM50227000
Substrate/Competitorn/a
Meas. Tech.ChEMBL_461467
Ki 21±n/a nM
Citation Biju PTaveras AYu YZheng JChao JRindgen DJakway JHipkin RWFossetta JFan XFine JQiu HMerritt JRBaldwin JJ 3,4-Diamino-2,5-thiadiazole-1-oxides as potent CXCR2/CXCR1 antagonists. Bioorg Med Chem Lett 18:228-31 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
C-X-C chemokine receptor type 1
Name:C-X-C chemokine receptor type 1
Synonyms:C-X-C chemokine receptor type 1 (CXCR-1) | C-X-C chemokine receptor type 1 (CXCR1) | Interleukin-8 receptor A | Interleukin-8 receptors, CXCR1/CXCR2
Type:Enzyme
Mol. Mass.:39803.83
Organism:Homo sapiens (Human)
Description:P25024
Residue:350
Sequence:
MSNITDPQMWDFDDLNFTGMPPADEDYSPCMLETETLNKYVVIIAYALVFLLSLLGNSLV
MLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCKVVSLLKEVN
FYSGILLLACISVDRYLAIVHATRTLTQKRHLVKFVCLGCWGLSMNLSLPFFLFRQAYHP
NNSSPVCYEVLGNDTAKWRMVLRILPHTFGFIVPLFVMLFCYGFTLRTLFKAHMGQKHRA
MRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQESCERRNNIGRALDATEILGFLHSCL
NPIIYAFIGQNFRHGFLKILAMHGLVSKEFLARHRVTSYTSSSVNVSSNL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50227000
n/a
NameBDBM50227000
Synonyms:3-[4-((R)-1-furan-2-yl-2,2-dimethyl-propylamino)-1-oxo-1H-1lambda4-[1,2,5]thiadiazol-3-ylamino]-2-hydroxy-N,N-dimethyl-benzamide | CHEMBL403547
TypeSmall organic molecule
Emp. Form.C20H25N5O4S
Mol. Mass.431.509
SMILESCN(C)C(=O)c1cccc(Nc2ns(=O)nc2N[C@@H](c2ccco2)C(C)(C)C)c1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: