Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLmbE-related protein
LigandBDBM50227096
Substrate/Competitorn/a
Meas. Tech.ChEMBL_452329
IC50 105000±n/a nM
Citation Metaferia BBFetterolf BJShazad-Ul-Hussan SMoravec MSmith JARay SGutierrez-Lugo MTBewley CA Synthesis of natural product-inspired inhibitors of Mycobacterium tuberculosis mycothiol-associated enzymes: the first inhibitors of GlcNAc-Ins deacetylase. J Med Chem 50:6326-36 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
LmbE-related protein
Name:LmbE-related protein
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:31733.34
Organism:Mycobacterium tuberculosis
Description:ChEMBL_627600
Residue:303
Sequence:
MSETPRLLFVHAHPDDESLSNGATIAHYTSRGAQVHVVTCTLGEEGEVIGDRWAQLTADH
ADQLGGYRIGELTAALRALGVSAPIYLGGAGRWRDSGMAGTDQRSQRRFVDADPRQTVGA
LVAIIRELRPHVVVTYDPNGGYGHPDHVHTHTVTTAAVAAAGVGSGTADHPGDPWTVPKF
YWTVLGLSALISGARALVPDDLRPEWVLPRADEIAFGYSDDGIDAVVEADEQARAAKVAA
LAAHATQVVVGPTGRAAALSNNLALPILADEHYVLAGGSAGARDERGWETDLLAGLGFTA
SGT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50227096
n/a
NameBDBM50227096
Synonyms:(E)-N-((2R,3R,4R,5S,6R)-2-(cyclohexylthio)-4,5-dihydroxy-6-(hydroxymethyl)-tetrahydro-2H-pyran-3-yl)-4-phenylbut-1-ene-1-sulfonamide | CHEMBL428030
TypeSmall organic molecule
Emp. Form.C22H33NO6S2
Mol. Mass.471.631
SMILESOC[C@@H]1O[C@@H](SC2CCCCC2)[C@@H](NS(=O)(=O)\C=C\CCc2ccccc2)[C@H](O)[C@H]1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: