Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPhenylethanolamine N-methyltransferase
LigandBDBM10758
Substrate/Competitorn/a
Meas. Tech.ChEMBL_461584
Ki 220000±n/a nM
Citation Grunewald GLSeim MRBhat SRWilson MECriscione KR Synthesis of 4,5,6,7-tetrahydrothieno[3,2-c]pyridines and comparison with their isosteric 1,2,3,4-tetrahydroisoquinolines as inhibitors of phenylethanolamine N-methyltransferase. Bioorg Med Chem 16:542-59 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Phenylethanolamine N-methyltransferase
Name:Phenylethanolamine N-methyltransferase
Synonyms:Noradrenaline N-methyltransferase | PNMTase
Type:Enzyme
Mol. Mass.:30916.97
Organism:Bos taurus (bovine)
Description:n/a
Residue:283
Sequence:
MSGTDRSQAAGAVPDSDPGLAAVSSAYQRFEPRAYLRNNYAPPRGDLSCPDGVGPWKLRC
LAQTFATGEVSGRTLIDIGSGPTIYQLLSACAHFEDITMTDFLEVNRQELRLWLREEPGA
FDWSVYSQHVCLIEGKGESWQEKECQLRARVKRILPIDVHRPQPLGAGGLAPLPADALVS
AFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLAVVPVREEEVR
EALVRTATRCGICARTPMPAHLQTGVDDVKGIFFTRAQKKVGV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM10758
n/a
NameBDBM10758
Synonyms:14C-phenylethylamine | 2-phenylethan-1-amine | CHEMBL610 | phenylethylamine
TypeSmall organic molecule
Emp. Form.C8H11N
Mol. Mass.121.1796
SMILESNCCc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: