Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetC-X-C chemokine receptor type 3
LigandBDBM50227871
Substrate/Competitorn/a
Meas. Tech.ChEMBL_461636
Ki 650±n/a nM
Citation Watson RJAllen DRBirch HLChapman GAGalvin FCJopling LAKnight RLMeier DOliver KMeissner JWOwen DAThomas EJTremayne NWilliams SC Development of CXCR3 antagonists. Part 3: Tropenyl and homotropenyl-piperidine urea derivatives. Bioorg Med Chem Lett 18:147-51 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
C-X-C chemokine receptor type 3
Name:C-X-C chemokine receptor type 3
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:41020.84
Organism:Mus musculus
Description:ChEMBL_560734
Residue:367
Sequence:
MYLEVSERQVLDASDFAFLLENSTSPYDYGENESDFSDSPPCPQDFSLNFDRTFLPALYS
LLFLLGLLGNGAVAAVLLSQRTALSSTDTFLLHLAVADVLLVLTLPLWAVDAAVQWVFGP
GLCKVAGALFNINFYAGAFLLACISFDRYLSIVHATQIYRRDPRVRVALTCIVVWGLCLL
FALPDFIYLSANYDQRLNATHCQYNFPQVGRTALRVLQLVAGFLLPLLVMAYCYAHILAV
LLVSRGQRRFRAMRLVVVVVAAFAVCWTPYHLVVLVDILMDVGVLARNCGRESHVDVAKS
VTSGMGYMHCCLNPLLYAFVGVKFREQMWMLFTRLGRSDQRGPQRQPSSSRRESSWSETT
EASYLGL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50227871
n/a
NameBDBM50227871
Synonyms:1-(1-((8-acetyl-8-aza-bicyclo[3.2.1]octan-3-yl)methyl)piperidin-4-yl)-3-(3-fluoro-5-(trifluoromethyl)phenyl)urea | CHEMBL403740
TypeSmall organic molecule
Emp. Form.C23H30F4N4O2
Mol. Mass.470.5035
SMILESCC(=O)N1C2CCC1CC(CN1CCC(CC1)NC(=O)Nc1cc(F)cc(c1)C(F)(F)F)C2 |w:9.10,7.8,4.35,TLB:1:3:9.8.32:5.6,TEB:10:9:5.6:3|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: