Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPeroxisome proliferator-activated receptor delta
LigandBDBM50229205
Substrate/Competitorn/a
Meas. Tech.ChEMBL_461777
EC50>10000±n/a nM
Citation Faucher NMartres PLaroze APineau OPotvain FGrillot D Design, synthesis and evaluation of trifluoromethane sulfonamide derivatives as new potent and selective peroxisome proliferator-activated receptor alpha agonists. Bioorg Med Chem Lett 18:710-5 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Peroxisome proliferator-activated receptor delta
Name:Peroxisome proliferator-activated receptor delta
Synonyms:NUC1 | Nuclear hormone receptor 1 | Nuclear receptor subfamily 1 group C member 2 | PPAR-beta | PPAR-delta
Type:PROTEIN
Mol. Mass.:49719.14
Organism:Mus musculus
Description:ChEMBL_1288931
Residue:440
Sequence:
MEQPQEETPEAREEEKEEVAMGDGAPELNGGPEHTLPSSSCADLSQNSSPSSLLDQLQMG
CDGASGGSLNMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCDRICKIQKKN
RNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGLTASEGCQHNPQLADLKAFSKH
IYNAYLKNFNMTKKKARSILTGKSSHNAPFVIHDIETLWQAEKGLVWKQLVNGLPPYNEI
SVHVFYRCQSTTVETVRELTEFAKNIPNFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKD
GLLVANGSGFVTHEFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDR
PGLMNVPQVEAIQDTILRALEFHLQVNHPDSQYLFPKLLQKMADLRQLVTEHAQMMQWLK
KTESETLLHPLLQEIYKDMY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50229205
n/a
NameBDBM50229205
Synonyms:CHEMBL253520 | N-(4-((trifluoromethylsulfonamido)methyl)benzyl)-4-methyl-2-(4-(trifluoromethyl)phenyl)thiazole-5-carboxamide
TypeSmall organic molecule
Emp. Form.C21H17F6N3O3S2
Mol. Mass.537.498
SMILESCc1nc(sc1C(=O)NCc1ccc(CNS(=O)(=O)C(F)(F)F)cc1)-c1ccc(cc1)C(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: