Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPeripheral-Type Benzodiazepine Receptor
LigandBDBM50229593
Substrate/Competitorn/a
Meas. Tech.ChEMBL_460138
Ki 0.0978±n/a nM
Citation Briard EZoghbi SSImaizumi MGourley JPShetty HUHong JCropley VFujita MInnis RBPike VW Synthesis and evaluation in monkey of two sensitive 11C-labeled aryloxyanilide ligands for imaging brain peripheral benzodiazepine receptors in vivo. J Med Chem 51:17-30 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Peripheral-Type Benzodiazepine Receptor
Name:Benzodiazepine receptors; peripheral & central
Synonyms:Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor (PBR)
Type:Mitochondrion membrane protein
Mol. Mass.:18945.84
Organism:Rattus norvegicus (rat)
Description:Competitive binding experiments were performed on rat kidney mitochondrial membranes.
Residue:169
Sequence:
MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50229593
n/a
NameBDBM50229593
Synonyms:CHEMBL253596 | N-acetyl-N-(2-methoxycarbonylbenzyl)-2-phenoxyaniline
TypeSmall organic molecule
Emp. Form.C23H21NO4
Mol. Mass.375.4171
SMILESCOC(=O)c1ccccc1CN(C(C)=O)c1ccccc1Oc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: