Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDisintegrin and metalloproteinase domain-containing protein 10 (ADAM10)
LigandBDBM50229651
Substrate/Competitorn/a
Meas. Tech.ChEMBL_461861
IC50 6.5±n/a nM
Citation Burns DMHe CLi YScherle PLiu XMarando CACovington MBYang GPan MTurner SFridman JSHollis GVaddi KYeleswaram SNewton RFriedman SMetcalf BYao W Conversion of an MMP-potent scaffold to an MMP-selective HER-2 sheddase inhibitor via scaffold hybridization and subtle P1' permutations. Bioorg Med Chem Lett 18:560-4 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Disintegrin and metalloproteinase domain-containing protein 10 (ADAM10)
Name:ADAM10
Synonyms:ADAM10
Type:Enzyme
Mol. Mass.:84160.93
Organism:Homo sapiens (Human)
Description:O14672
Residue:748
Sequence:
MVLLRVLILLLSWAAGMGGQYGNPLNKYIRHYEGLSYNVDSLHQKHQRAKRAVSHEDQFL
RLDFHAHGRHFNLRMKRDTSLFSDEFKVETSNKVLDYDTSHIYTGHIYGEEGSFSHGSVI
DGRFEGFIQTRGGTFYVEPAERYIKDRTLPFHSVIYHEDDINYPHKYGPQGGCADHSVFE
RMRKYQMTGVEEVTQIPQEEHAANGPELLRKKRTTSAEKNTCQLYIQTDHLFFKYYGTRE
AVIAQISSHVKAIDTIYQTTDFSGIRNISFMVKRIRINTTADEKDPTNPFRFPNIGVEKF
LELNSEQNHDDYCLAYVFTDRDFDDGVLGLAWVGAPSGSSGGICEKSKLYSDGKKKSLNT
GIITVQNYGSHVPPKVSHITFAHEVGHNFGSPHDSGTECTPGESKNLGQKENGNYIMYAR
ATSGDKLNNNKFSLCSIRNISQVLEKKRNNCFVESGQPICGNGMVEQGEECDCGYSDQCK
DECCFDANQPEGRKCKLKPGKQCSPSQGPCCTAQCAFKSKSEKCRDDSDCAREGICNGFT
ALCPASDPKPNFTDCNRHTQVCINGQCAGSICEKYGLEECTCASSDGKDDKELCHVCCMK
KMDPSTCASTGSVQWSRHFSGRTITLQPGSPCNDFRGYCDVFMRCRLVDADGPLARLKKA
IFSPELYENIAEWIVAHWWAVLLMGIALIMLMAGFIKICSVHTPSSNPKLPPPKPLPGTL
KRRRPPQPIQQPQRQRPRESYQMGHMRR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50229651
n/a
NameBDBM50229651
Synonyms:(S)-pyrrolidin-2-ylmethyl 4-((4-(4-cyano-2-methylphenyl)piperidin-1-ylsulfonyl)methyl)-4-(hydroxycarbamoyl)piperidine-1-carboxylate | CHEMBL253021
TypeSmall organic molecule
Emp. Form.C26H37N5O6S
Mol. Mass.547.667
SMILESCc1cc(ccc1C1CCN(CC1)S(=O)(=O)CC1(CCN(CC1)C(=O)OC[C@@H]1CCCN1)C(=O)NO)C#N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: