Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetD(3) dopamine receptor
LigandBDBM50054067
Substrate/Competitorn/a
Meas. Tech.ChEMBL_460309
Ki 2.35±n/a nM
Citation Biswas SZhang SFernandez FGhosh BZhen JKuzhikandathil EReith MEDutta AK Further structure-activity relationships study of hybrid 7-{[2-(4-phenylpiperazin-1-yl)ethyl]propylamino}-5,6,7,8-tetrahydronaphthalen-2-ol analogues: identification of a high-affinity D3-preferring agonist with potent in vivo activity with long duration of action. J Med Chem 51:101-17 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
D(3) dopamine receptor
Name:D(3) dopamine receptor
Synonyms:D2-like dopamine receptor | DOPAMINE D3 | DRD3 | Dopamine D3 receptor | Dopamine D3 receptor (D3) | Dopamine D3 receptor (D3R) | Dopamine receptor | Dopamine receptor (D3) | Dopamine receptor D3
Type:n/a
Mol. Mass.:44243.43
Organism:Homo sapiens (Human)
Description:n/a
Residue:400
Sequence:
MASLSQLSSHLNYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLVCMAVLKERAL
QTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILN
LCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPTV
CSISNPDFVIYSSVVSFYLPFGVTVLVYARIYVVLKQRRRKRILTRQNSQCNSVRPGFPQ
QTLSPDPAHLELKRYYSICQDTALGGPGFQERGGELKREEKTRNSLSPTIAPKLSLEVRK
LSNGRLSTSLKLGPLQPRGVPLREKKATQMVAIVLGAFIVCWLPFFLTHVLNTHCQTCHV
SPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKILSC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50054067
n/a
NameBDBM50054067
Synonyms:(2R)-7-Dipropylamino-5,6,7,8-tetrahydro-naphthalen-2-ol | (7-Hydroxy-1,2,3,4-tetrahydro-naphthalen-2-yl)-dipropyl-ammonium(R(+)7OH-DPAT) | (R)-7-(dipropylamino)-5,6,7,8-tetrahydronaphthalen-2-ol | (R)-7-Dipropylamino-5,6,7,8-tetrahydro-naphthalen-2-ol | (R)-7-Dipropylamino-5,6,7,8-tetrahydro-naphthalen-2-ol.HCl | 7-Dipropylamino-5,6,7,8-tetrahydro-naphthalen-2-ol | CHEMBL301559
TypeSmall organic molecule
Emp. Form.C16H25NO
Mol. Mass.247.3758
SMILESCCCN(CCC)[C@@H]1CCc2ccc(O)cc2C1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: