Reaction Details |
| Report a problem with these data |
Target | C-X-C chemokine receptor type 1 |
---|
Ligand | BDBM50233590 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_462399 (CHEMBL927215) |
---|
IC50 | 345±n/a nM |
---|
Citation | Yu, Y; Dwyer, MP; Chao, J; Aki, C; Chao, J; Purakkattle, B; Rindgen, D; Bond, R; Mayer-Ezel, R; Jakway, J; Qiu, H; Hipkin, RW; Fossetta, J; Gonsiorek, W; Bian, H; Fan, X; Terminelli, C; Fine, J; Lundell, D; Merritt, JR; He, Z; Lai, G; Wu, M; Taveras, A Synthesis and structure-activity relationships of heteroaryl substituted-3,4-diamino-3-cyclobut-3-ene-1,2-dione CXCR2/CXCR1 receptor antagonists. Bioorg Med Chem Lett18:1318-22 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
C-X-C chemokine receptor type 1 |
---|
Name: | C-X-C chemokine receptor type 1 |
Synonyms: | C-X-C chemokine receptor type 1 (CXCR-1) | C-X-C chemokine receptor type 1 (CXCR1) | CMKAR1 | CXCR1 | CXCR1_HUMAN | IL8RA | Interleukin-8 receptor A | Interleukin-8 receptors, CXCR1/CXCR2 |
Type: | Enzyme |
Mol. Mass.: | 39803.83 |
Organism: | Homo sapiens (Human) |
Description: | P25024 |
Residue: | 350 |
Sequence: | MSNITDPQMWDFDDLNFTGMPPADEDYSPCMLETETLNKYVVIIAYALVFLLSLLGNSLV
MLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCKVVSLLKEVN
FYSGILLLACISVDRYLAIVHATRTLTQKRHLVKFVCLGCWGLSMNLSLPFFLFRQAYHP
NNSSPVCYEVLGNDTAKWRMVLRILPHTFGFIVPLFVMLFCYGFTLRTLFKAHMGQKHRA
MRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQESCERRNNIGRALDATEILGFLHSCL
NPIIYAFIGQNFRHGFLKILAMHGLVSKEFLARHRVTSYTSSSVNVSSNL
|
|
|
BDBM50233590 |
---|
n/a |
---|
Name | BDBM50233590 |
Synonyms: | 3-(2-(1-(4-(3,5-dimethylisoxazol-4-yl)furan-2-yl)propylamino)-3,4-dioxocyclobut-1-enylamino)-2-hydroxy-N,N-dimethylbenzamide | CHEMBL253706 |
Type | Small organic molecule |
Emp. Form. | C25H26N4O6 |
Mol. Mass. | 478.4971 |
SMILES | CCC(Nc1c(Nc2cccc(C(=O)N(C)C)c2O)c(=O)c1=O)c1cc(co1)-c1c(C)noc1C |w:2.2| |
Structure |
|