Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLeucine aminopeptidase
LigandBDBM50225458
Substrate/Competitorn/a
Meas. Tech.ChEMBL_462623
Ki 45±n/a nM
Citation Mucha ALämmerhofer MLindner WPawelczak MKafarski P Individual stereoisomers of phosphinic dipeptide inhibitor of leucine aminopeptidase. Bioorg Med Chem Lett 18:1550-4 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Leucine aminopeptidase
Name:Aminopeptidase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:56171.75
Organism:Homo sapiens (Human)
Description:ChEMBL_1507539
Residue:519
Sequence:
MFLLPLPAAGRVVVRRLAVRRFGSRSLSTADMTKGLVLGIYSKEKEDDVPQFTSAGENFD
KLLAGKLRETLNISGPPLKAGKTRTFYGLHQDFPSVVLVGLGKKAAGIDEQENWHEGKEN
IRAAVAAGCRQIQDLELSSVEVDPCGDAQAAAEGAVLGLYEYDDLKQKKKMAVSAKLYGS
GDQEAWQKGVLFASGQNLARQLMETPANEMTPTRFAEIIEKNLKSASSKTEVHIRPKSWI
EEQAMGSFLSVAKGSDEPPVFLEIHYKGSPNANEPPLVFVGKGITFDSGGISIKASANMD
LMRADMGGAATICSAIVSAAKLNLPINIIGLAPLCENMPSGKANKPGDVVRAKNGKTIQV
DNTDAEGRLILADALCYAHTFNPKVILNAATLTGAMDVALGSGATGVFTNSSWLWNKLFE
ASIETGDRVWRMPLFEHYTRQVVDCQLADVNNIGKYRSAGACTAAAFLKEFVTHPKWAHL
DIAGVMTNKDEVPYLRKGMTGRPTRTLIEFLLRFSQDNA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50225458
n/a
NameBDBM50225458
Synonyms:(2S)-3-[(R)-[(1S)-1-amino-3-phenylpropyl](hydroxy)phosphoryl]-2-benzylpropanoic acid | (S)-3-[((S)-1-amino-3-phenyl-propyl)-hydroxy-phosphinoyl]-2-benzyl-propionic acid | CHEMBL254284 | CHEMBL393949
TypeSmall organic molecule
Emp. Form.C19H24NO4P
Mol. Mass.361.3719
SMILESOC(=O)[C@H](Cc1ccccc1)CP(O)(O)C(=N)CCc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: