Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetInterleukin-8 receptors, CXCR2
LigandBDBM50236052
Substrate/Competitorn/a
Meas. Tech.ChEMBL_462928
Ki 4.5±n/a nM
Citation Lai GMerritt JRHe ZFeng DChao JCzarniecki MFRokosz LLStauffer TMRindgen DTaveras AG Synthesis and structure-activity relationships of new disubstituted phenyl-containing 3,4-diamino-3-cyclobutene-1,2-diones as CXCR2 receptor antagonists. Bioorg Med Chem Lett 18:1864-8 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Interleukin-8 receptors, CXCR2
Name:Interleukin-8 receptors, CXCR1/CXCR2
Synonyms:C-X-C chemokine receptor type 2 (CXCR-2) | C-X-C chemokine receptor type 2 (CXCR2) | CD_antigen=CD182 | CDw128b | CXCR-2 | Chemokine receptor type 2 (CXCR2) | GRO/MGSA receptor | High affinity interleukin-8 receptor B | IL-8 receptor type 2 | IL-8R B | Interleukin-8 receptor B
Type:Protein
Mol. Mass.:40767.88
Organism:Homo sapiens (Human)
Description:P25025
Residue:360
Sequence:
MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYFVVIIYALVFL
LSLLGNSLVMLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCK
VVSLLKEVNFYSGILLLACISVDRYLAIVHATRTLTQKRYLVKFICLSIWGLSLLLALPV
LLFRRTVYSSNVSPACYEDMGNNTANWRMLLRILPQSFGFIVPLLIMLFCYGFTLRTLFK
AHMGQKHRAMRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQETCERRNHIDRALDATE
ILGILHSCLNPLIYAFIGQKFRHGLLKILAIHGLISKDSLPKDSRPSFVGSSSGHTSTTL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50236052
n/a
NameBDBM50236052
Synonyms:(R)-3-(2-(cyclopropyl(3,5-difluorophenyl)methylamino)-3,4-dioxocyclobut-1-enylamino)-2-hydroxy-N,N-dimethylbenzamide | CHEMBL254776
TypeSmall organic molecule
Emp. Form.C23H21F2N3O4
Mol. Mass.441.4273
SMILESCN(C)C(=O)c1cccc(Nc2c(N[C@H](C3CC3)c3cc(F)cc(F)c3)c(=O)c2=O)c1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: