Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-1
LigandBDBM50242263
Substrate/Competitorn/a
Meas. Tech.ChEMBL_549443
IC50 3510±n/a nM
Citation Lee JSCho YSPark EJKim JOh WKLee HSAhn JS Phospholipase Cgamma1 inhibitory principles from the sarcotestas of Ginkgo biloba. J Nat Prod 61:867-71 (1998) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-1
Name:1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-1
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:148298.56
Organism:Bos taurus
Description:ChEMBL_549444
Residue:1291
Sequence:
MAGAASPCANGCGPSAPSDAEVVHLCRSLEVGTVMTLFYSKKSQRPERKTFQVKLETRQI
TWSRGADKIEGAIDIREIKEIRPGKTSRDFDRYQEDPAFRPDQSHCFVILYGMEFRLKTL
SLQATSEDEVNMWIRGLTWLMEDTLQAATPLQIERWLRKQFYSVDRNREDRISAKDLKNM
LSQVNYRVPNMRFLRERLTDLEQRTSDITYGQFAQLYRSLMYSAQKTMDLPFLEASALRA
GERPELCRVSLPEFQQFLLEYQGELWAVDRLQVQEFMLSFLRDPLREIEEPYFFLDEFVT
FLFSKENSIWNSQLDEVCPDTMNNPLSHYWISSSHNTYLTGDQFSSESSLEAYARCLRMG
CRCIELDCWDGPDGMPVIYHGHTLTTKIKFSDVLHTIKEHAFVASEYPVILSIEDHCSIA
QQRNMAQYFKKVLGDTLLTKPVDIAADGLPSPNQLKRKILIKHKKLAEGSAYEEVPTSVM
YSENDISNSIKNGILYLEDPVNHEWYPHYFVLTSSKIYYSEETSSDQGNEDEEEPKEASG
STELHSNEKWFHGKLGAGRDGRHIAERLLTEYCIETGAPDGSFLVRESETFVGDYTLSFW
RNGKVQHCRIHSRQDAGTPKFFLTDNLVFDSLYDLITHYQQVPLRCNEFEMRLSEPVPQT
NAHESKEWYHASLTRAQAEHMLMRVPRDGAFLVRKRNEPNSYAISFRAEGKIKHCRVQQE
GQTVMLGNSEFDSLVDLISYYEKHPLYRKMKLRYPINEEALEKIGTAEPDYGALYEGRNP
GFYVEANPMPTFKCAVKALFDYKAQREDELTFTKSAIIQNVEKQEGGWWRGDYGGKKQLW
FPSNYVEEMVSPAALEPEREHLDENSPLGDLLRGVLDVPACQIAVRPEGKNNRLFVFSIS
MASVAHWSLDVAADSQEELQDWVKKIREVAQTADARLTEGKMMERRKKIALELSELVVYC
RPVPFDEEKIGTERACYRDMSSFPETKAEKYVNKAKGKKFLQYNRLQLSRIYPKGQRLDS
SNYDPLPMWICGSQLVALNFQTPDKPMQMNQALFLAGGHCGYVLQPSVMRDEAFDPFDKS
SLRGLEPCAICIEVLGARHLPKNGRGIVCPFVEIEVAGAEYDSIKQKTEFVVDNGLNPVW
PAKPFHFQISNPEFAFLRFVVYEEDMFSDQNFLAQATFPVKGLKTGYRAVPLKNNYSEGL
ELASLLVKIDVFPAKQENGDLSPFGGASLRERSCDASGPLFHGRAREGSFEARYQQPFED
FRISQEHLADHFDGRDRRTPRRTRVNGDNRL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50242263
n/a
NameBDBM50242263
Synonyms:(Z)-3-(pentadec-8-enyl)phenol | 3-[8'(Z)-pentadecenyl]phenol | 5-{8(Z)-pentadecenyl}phenol | CHEMBL470263
TypeSmall organic molecule
Emp. Form.C21H34O
Mol. Mass.302.4941
SMILESCCCCCC\C=C/CCCCCCCc1cccc(O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: