Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTrypsin
LigandBDBM50150484
Substrate/Competitorn/a
Meas. Tech.ChEMBL_550822
IC50>200000±n/a nM
Citation Wang DGirard TJKasten TPLaChance RMMiller-Wideman MADurley RC Inhibitory activity of unsaturated fatty acids and anacardic acids toward soluble tissue factor-factor VIIa complex. J Nat Prod 61:1352-5 (1999) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Trypsin
Name:Trypsin
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:24411.24
Organism:Sus scrofa
Description:ChEMBL_1450738
Residue:231
Sequence:
FPTDDDDKIVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGE
HNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCAAA
GTECLISGWGNTKSSGSSYPSLLQCLKAPVLSDSSCKSSYPGQITGNMICVGFLEGGKDS
CQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWIQQTIAAN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50150484
n/a
NameBDBM50150484
Synonyms:(Z)-9-octadecenoic acid | (Z)-Octadec-9-enoic acid | CHEMBL8659 | OLEATE | Octadec-9-enoic acid | oleaic acid | oleicacid
TypeSmall organic molecule
Emp. Form.C18H34O2
Mol. Mass.282.4614
SMILESCCCCCCCC\C=C/CCCCCCCC(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: