Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCoagulation factor VII/tissue factor
LigandBDBM50269540
Substrate/Competitorn/a
Meas. Tech.ChEMBL_550824
IC50 33000±n/a nM
Citation Wang DGirard TJKasten TPLaChance RMMiller-Wideman MADurley RC Inhibitory activity of unsaturated fatty acids and anacardic acids toward soluble tissue factor-factor VIIa complex. J Nat Prod 61:1352-5 (1999) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Coagulation factor VII/tissue factor
Name:Coagulation factor VII/tissue factor
Synonyms:CD_antigen=CD142 | Coagulation factor III | TF | Thromboplastin | Tissue factor
Type:PROTEIN
Mol. Mass.:33067.61
Organism:Homo sapiens (Human)
Description:ChEMBL_936735
Residue:295
Sequence:
METPAWPRVPRPETAVARTLLLGWVFAQVAGASGTTNTVAAYNLTWKSTNFKTILEWEPK
PVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGS
AGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFG
KDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVE
CMGQEKGEFREIFYIIGAVVFVVIILVIILAISLHKCRKAGVGQSWKENSPLNVS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50269540
n/a
NameBDBM50269540
Synonyms:6-(8'Z,11'Z-heptadecadienyl)-salicylicacid | CHEMBL465196
TypeSmall organic molecule
Emp. Form.C24H36O3
Mol. Mass.372.5408
SMILESCCCCC\C=C/C\C=C/CCCCCCCc1cccc(O)c1C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: