Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCell division protein kinase 5
LigandBDBM7458
Substrate/Competitorn/a
Meas. Tech.ChEMBL_548295
EC50>250000±n/a nM
Citation Zapata-Torres GOpazo FSalgado CMuñoz JPKrautwurst HMascayano CSepúlveda-Boza SMaccioni RBCassels BK Effects of natural flavones and flavonols on the kinase activity of Cdk5. J Nat Prod 67:416-20 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cell division protein kinase 5
Name:Cell division protein kinase 5
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:33258.60
Organism:Rattus norvegicus
Description:ChEMBL_548295
Residue:292
Sequence:
MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKH
KNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSLLFQLLKGLGFCHSR
NVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYS
TSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPAMTKLPDYKPYP
MYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM7458
n/a
NameBDBM7458
Synonyms:5,7-dihydroxy-2-(4-hydroxyphenyl)-4H-chromen-4-one | 5,7-dihydroxy-2-(4-hydroxyphenyl)-chromen-4-one | Apigenin | Apigenin (2) | Apigenin (3) | Apigenin (7) | Apigenin, 13 | CHEMBL28 | Naringenin, 18 | cid_5280443
TypeSmall organic molecule
Emp. Form.C15H10O5
Mol. Mass.270.2369
SMILESOc1ccc(cc1)-c1cc(=O)c2c(O)cc(O)cc2o1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: