Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCell division protein kinase 5
LigandBDBM7460
Substrate/Competitorn/a
Meas. Tech.ChEMBL_548295
EC50 63400±n/a nM
Citation Zapata-Torres GOpazo FSalgado CMuñoz JPKrautwurst HMascayano CSepúlveda-Boza SMaccioni RBCassels BK Effects of natural flavones and flavonols on the kinase activity of Cdk5. J Nat Prod 67:416-20 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cell division protein kinase 5
Name:Cell division protein kinase 5
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:33258.60
Organism:Rattus norvegicus
Description:ChEMBL_548295
Residue:292
Sequence:
MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKH
KNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSLLFQLLKGLGFCHSR
NVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYS
TSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPAMTKLPDYKPYP
MYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM7460
n/a
NameBDBM7460
Synonyms:2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-4H-chromen-4-one | 2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-chromen-4-one | 2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-chromone;hydrate | CHEMBL50 | Quercetin | Quercetin (10) | Quercetin (21) | Quercetin (Qur) | US9180183, Quercetin
TypeSmall organic molecule
Emp. Form.C15H10O7
Mol. Mass.302.2357
SMILESOc1cc(O)c2c(c1)oc(-c1ccc(O)c(O)c1)c(O)c2=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: