Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAnandamide amidohydrolase
LigandBDBM26736
Substrate/Competitorn/a
Meas. Tech.ChEMBL_530431
IC50 2.1±n/a nM
Citation Ortar GCascio MGMoriello ASCamalli MMorera ENalli MDi Marzo V Carbamoyl tetrazoles as inhibitors of endocannabinoid inactivation: a critical revisitation. Eur J Med Chem 43:62-72 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Anandamide amidohydrolase
Name:Anandamide amidohydrolase
Synonyms:Anandamide amidohydrolase 1 | FAAH | Fatty Acid Amide Hydrolase | Fatty Acid Amide Hydrolic, FAAH | Fatty-acid amide hydrolase (FAAH) | Fatty-acid amide hydrolase 1 | Fatty-acid amide hydrolase 1 (FAAH) | Oleamide hydrolase 1
Type:Single-pass membrane protein; homodimer
Mol. Mass.:63364.46
Organism:Rattus norvegicus (rat)
Description:Membranes prepared from rat brain were used in assay.
Residue:579
Sequence:
MVLSEVWTTLSGVSGVCLACSLLSAAVVLRWTGRQKARGAATRARQKQRASLETMDKAVQ
RFRLQNPDLDSEALLTLPLLQLVQKLQSGELSPEAVFFTYLGKAWEVNKGTNCVTSYLTD
CETQLSQAPRQGLLYGVPVSLKECFSYKGHDSTLGLSLNEGMPSESDCVVVQVLKLQGAV
PFVHTNVPQSMLSFDCSNPLFGQTMNPWKSSKSPGGSSGGEGALIGSGGSPLGLGTDIGG
SIRFPSAFCGICGLKPTGNRLSKSGLKGCVYGQTAVQLSLGPMARDVESLALCLKALLCE
HLFTLDPTVPPLPFREEVYRSSRPLRVGYYETDNYTMPSPAMRRALIETKQRLEAAGHTL
IPFLPNNIPYALEVLSAGGLFSDGGRSFLQNFKGDFVDPCLGDLILILRLPSWFKRLLSL
LLKPLFPRLAAFLNSMRPRSAEKLWKLQHEIEMYRQSVIAQWKAMNLDVLLTPMLGPALD
LNTPGRATGAISYTVLYNCLDFPAGVVPVTTVTAEDDAQMELYKGYFGDIWDIILKKAMK
NSVGLPVAVQCVALPWQEELCLRFMREVEQLMTPQKQPS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM26736
n/a
NameBDBM26736
Synonyms:CHEMBL509860 | LY2183240 | N,N-dimethyl-5-[(4-phenylphenyl)methyl]-1H-1,2,3,4-tetrazole-1-carboxamide
TypeSmall organic molecule
Emp. Form.C17H17N5O
Mol. Mass.307.3498
SMILESCN(C)C(=O)n1nnnc1Cc1ccc(cc1)-c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: