Reaction Details |
| Report a problem with these data |
Target | Cyclin-dependent kinase 1 |
---|
Ligand | BDBM50245692 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_511073 (CHEMBL1000365) |
---|
IC50 | 710±n/a nM |
---|
Citation | Smaill, JB; Baker, EN; Booth, RJ; Bridges, AJ; Dickson, JM; Dobrusin, EM; Ivanovic, I; Kraker, AJ; Lee, HH; Lunney, EA; Ortwine, DF; Palmer, BD; Quin, J; Squire, CJ; Thompson, AM; Denny, WA Synthesis and structure-activity relationships of N-6 substituted analogues of 9-hydroxy-4-phenylpyrrolo[3,4-c]carbazole-1,3(2H,6H)-diones as inhibitors of Wee1 and Chk1 checkpoint kinases. Eur J Med Chem43:1276-96 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Cyclin-dependent kinase 1 |
---|
Name: | Cyclin-dependent kinase 1 |
Synonyms: | CDC2 | CDC28A | CDK1 | CDK1_HUMAN | CDKN1 | Cell division control protein 2 homolog | Cell division protein kinase 1 | Cyclin-dependent kinase 1 (CDK1) | P34CDC2 | p34 protein kinase |
Type: | Enzyme Subunit |
Mol. Mass.: | 34101.08 |
Organism: | Homo sapiens (Human) |
Description: | P06493 |
Residue: | 297 |
Sequence: | MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRH
PNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCH
SRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSAR
YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNT
FPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM
|
|
|
BDBM50245692 |
---|
n/a |
---|
Name | BDBM50245692 |
Synonyms: | 4-(2-chlorophenyl)-9-hydroxy-6-(3-(methylamino)propyl)pyrrolo[3,4-c]carbazole-1,3(2H,6H)-dione | CHEMBL508541 |
Type | Small organic molecule |
Emp. Form. | C24H20ClN3O3 |
Mol. Mass. | 433.887 |
SMILES | CNCCCn1c2ccc(O)cc2c2c3C(=O)NC(=O)c3c(cc12)-c1ccccc1Cl |
Structure |
|